current user: public

If you have questions about the server, please let us know.

Query: PF05452.11; CLAVC_STYCL/1-80; Clavanin, from PfamA32U

Results of FFAS03 search in PfamA32U
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80
# Score Template Links and tools%idFirst MKTTILILLILGLGINAKSLEERKSEEEKVFHLLGKIIHHVGNFVYGFSHVFGDDQQDNGKFYGHYAEDNGKHWYDTGDQLast
1 -79.200PF05452.11; CLAVC_STYCL/1-80; Clavanin  ali  100  1MKTTILILLILGLGINAKSLEERKSEEEKVFHLLGKIIHHVGNFVYGFSHVFGDDQQDNGKFYGHYAEDNGKHWYDTGDQ 80
2 -8.330PF15887.5; L0DUU9_THIND/101-352; Putative zinc-binding metallo-peptidase  ali follow..  20  62.....LITLNIAEADPVTRERMRRDMAEPYRTILGHFRHESGHYYWEVRAVFGDETMDYTQALETHHARGARADW..... 142
3 -8.110PF14436.6; K9ZCI9_ANACC/290-423; Bacterial EndoU nuclease  ali follow..  35  4..............................................GFDHVFCGEPVSGGAIGGLH.............. 23
4 -7.740PF11129.8; Q8AGS8_9RETR/2-135; Rev protein of equine infectious anaemia virus  ali follow..  21  50.........IREQILQAEVLQERLEWRIRGVQQAAKELDEVNRGIWRELH-FREDQKGDFSAWGGYQRAQERHWGEQSS. 118
5 -7.720PF07259.12; PCSK1_MOUSE/1-188; ProSAAS precursor  ali follow..  25  17....ILVLLLLGLLRLPPTLSARPVKEPRSLSAAGEAAGAVQELARALAHLLEAERQERARAEAQEAEDQ.......... 101
6 -6.730PF12057.8; K7JNU2_NASVI/339-452; BCL2-associated athanogene 6  ali follow..  14  25.......LMLADPSLTPGSGPEGVAENQRIVDGVSECLHYLSHACHALSDIIVDMGQQPPR................... 78
7 -6.530PF03397.14; MATRX_IHNVW/8-175; Rhabdovirus matrix protein  ali follow..  23  92..TTYQVTKAREVYLQTQPLEKKIPMQTYSVSTEGATITFTGRFLFSSSHVGCDDNRT...................... 147
8 -6.210PF15555.6; F7I4I5_CALJA/33-155; Domain of unknown function (DUF4658 topsan)  ali follow..  17  74LRLCVCVLLVVALGLYCGRSKPVATALEDLRAWLLGLVLHLRHVVLT................................. 120
9 -6.150PF08763.11; G4V8E3_SCHMA/1462-1541; Voltage gated calcium channel IQ domain  ali follow..  15  1.TTTLFALVRESLGIKMAPAEFMDIKDAELRETIKTLWPVQADLLLPPDSEYTFTRLTVGKIYAGL.............. 69
10 -5.910PF16219.5; E0SMB4_DICD3/32-155; Domain of unknown function (DUF4879 topsan)  ali follow..  19  42.....IAVLEVGYGLNGGQTSPYQVNPVCVVSGRYTESCPAGSIVSGWMAYFNADNMSSVTF.................. 104

FFAS is supported by the NIH grant R01-GM087218-01
1 3 9 8 0 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Pawlowski K, Jaroszewski L, Bierzynski A, Godzik A. Multiple model approach--dealing with alignment ambiguities in protein modeling. Pac Symp Biocomput. 1997;:328-39.