current user: public

If you have questions about the server, please let us know.

Query: PF05545.11; F2IXK9_POLGS/3-51; Cbb3-type cytochrome oxidase component FixQ, from PfamA32U

Results of FFAS03 search in PfamA32U
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .
# Score Template Links and tools%idFirst ETYTSLAAFAQTWGLLYFVILFGIVLAYALWPKNRKRFEDAANIPFREDLast
1 -52.400PF05545.11; F2IXK9_POLGS/3-51; Cbb3-type cytochrome oxidase component FixQ  ali  100  1ETYTSLAAFAQTWGLLYFVILFGIVLAYALWPKNRKRFEDAANIPFRED 49
2 -7.940PF03032.15; Q800R3_PHYBI/2-46; Frog skin active peptide family signal and propeptide  ali follow..  15  7................LFLVLFLGLVSLSICEEEKRETEEKEYDQGEDD 39
3 -7.790PF03597.15; W8EYA9_9BACT/3-45; Cytochrome oxidase maturation protein cbb3-type  ali follow..  11  10...............LAVALTFLGAFLWAVRSGQYEDDYTPSVRMLFDD 43
4 -7.280PF12273.8; K1X614_MARBU/45-169; Chitin synthesis regulation, resistance to Congo red  ali follow..  26  2............WVALILVVIFFLLMGYLFSITRRRRQRGLA....... 31
5 -6.380PF05083.13; LST1_HUMAN/16-96; LST-1 protein  ali follow..  13  3.............GLLLLAVVLLSACLCWLHRRVKRLERSWAQGSSEQE 38
6 -6.200PF15681.5; H0WG11_OTOGA/29-376; Lymphocyte activation family X  ali follow..  23  6QSRSIFSGFAGVLAILLFVAVFCILWSWYKRKKWQVPFLQVAVMPI... 51
7 -5.980PF07850.14; Q7QDI6_ANOGA/227-323; Renin receptor-like protein  ali follow..  12  48SNYPVIFNII----VLVFSLLAISIVIGTMDPGRDSIIYRMTSTRMKKD 97
8 -5.780PF08135.11; VE5_PAPVE/1-43; Major transforming protein E5 family  ali follow..  24  2.TYGLLLFLGLTFGLQLMLLVFLLFFFLVW................... 30
9 -5.240PF17359.2; A0A0C5S2P0_9MOLU/14-235; Family of unknown function (DUF5385 topsan)  ali follow..  10  3.........SNFLTILIIIIPIILIIVFIVRKKRRQNGDGPSTGNNQNK 42
10 -5.230PF06664.12; T1IN05_STRMM/180-497; Wnt-binding factor required for Wnt secretion  ali follow..  11  285DDISLEYTSAFFCGVYGMWNIYVFALIVLYAPSH............... 318

FFAS is supported by the NIH grant R01-GM087218-01
1 3 9 8 0 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Pawlowski K, Jaroszewski L, Bierzynski A, Godzik A. Multiple model approach--dealing with alignment ambiguities in protein modeling. Pac Symp Biocomput. 1997;:328-39.