current user: public

If you have questions about the server, please let us know.

Query: PF06040.11; Q8UY74_9ADEN/13-145; Adenovirus E3 protein, from PfamA32U

Results of FFAS03 search in PfamA32U
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130
# Score Template Links and tools%idFirst IKAETATTPDFRVSKLQLFQPFLPGTYQCVSGPCHHTFHLIPNTTASLPTNNQTNLHQRHRRDLSESNTTTHTGGELRGQPTSGIYYGPWEVVGLITLGLVAGGLLVLCYLYLPCCSYLVVLCCWFKKWGRSLast
1 -121.000PF06040.11; Q8UY74_9ADEN/13-145; Adenovirus E3 protein  ali  100  1IKAETATTPDFRVSKLQLFQPFLPGTYQCVSGPCHHTFHLIPNTTASLPTNNQTNLHQRHRRDLSESNTTTHTGGELRGQPTSGIYYGPWEVVGLITLGLVAGGLLVLCYLYLPCCSYLVVLCCWFKKWGRS 132
2 -8.850PF10177.9; W5KY66_ASTMX/13-159; Uncharacterised conserved protein (DUF2371 topsan)  ali follow..  13  30VKGKLNLCSVSGMAAAFGVLVLMVGIAMAVLG----------PRENLAHTVSLQRVNDATINSTKPIPPASRHVGFFEDFFSNYQYSDNLKVFGPLVMGI--GIFLFIC....................... 128
3 -8.570PF15829.5; G1PQT6_MYOLU/1-225; Domain of unknown function (DUF4711 topsan)  ali follow..  22  112.SCHLTSTSNFQNGSLLTGKAFLPGIFQCKVYPAMRTLKAFPTTTTSITPGNKEGEKTTSIDDFSTPLKQQDTDENLEKRQKWSIVVKFL-IAGTLLFSGIAITVFVIFEVPCPC................. 225
4 -8.280PF05957.13; Q9HZG8_PSEAE/12-109; Bacterial protein of unknown function (DUF883 topsan)  ali follow..  11  7..................FQALVADTEKLLQSTADVAGDQAEEIRGKIHDSLKRARDTLRDTKDSLKDNVRERSQAAVDATEVYVGEHPWQSIGIAGVGFLLGLLV.......................... 95
5 -8.170PF09512.10; R7D9Z9_9FIRM/12-160; Thiamine-precursor transporter protein (ThiW)  ali follow..  12  28................................PVQHMVNVFAAVMLGPWWGIGIAFCASLIRNLLGIGSLLAFPGSMVGALCCGLVFRLTRKLSLTCVAEALGTGILGGLAAYPVAKLLM............ 115
6 -8.000PF08576.10; B3L4Z5_PLAKH/67-165; Eukaryotic protein of unknown function (DUF1764 topsan)  ali follow..  15  29.........................................GNETRPIKKNSEKSGLHGGPVHKKAKRLVAKGPITERARTSDG-----LPIYSMEELKMGQGGYTKDCPFECSCC................ 98
7 -7.930PF09988.9; K9TIP1_9CYAN/2-166; Uncharacterized metal-binding protein (DUF2227 topsan)  ali follow..  16  2..............................SGRTHDEITLWSSSLTLIVAGGFLFSGLMFGPDLDIYSQQFQRWGWLR------WIWLPYQQSSFLSHGPLVGTALRILYLGIWIGAIAFGV.......... 105
8 -7.900PF01309.18; GP2B_EAVBU/30-225; Equine arteritis virus small envelope glycoprotein  ali follow..  22  63IMPMPGLTPDFDHLESSSYAPFINAYRQAILSQYPQELQLEAINCKLLAVVAPALYHNYHLANLTGPATVVPTVGQLHYYASSSIFASSVEVLAAIILLFACIPLVTRVYI..................... 175
9 -6.970PF06184.11; COAT_SPMV/5-157; Potexvirus coat protein  ali follow..  21  5.........................................SNRRAGSRAAATSLVYDTCYVTLTERATTSFQRQSFPTLKGMG---RAFQVVAFTIQGVSAAPLMYNARLYNP.................. 75
10 -6.670PF03185.15; W5LYM2_LEPOC/37-228; Calcium-activated potassium channel, beta subunit  ali follow..  16  32VVRSYTESIWTGESNCTVLNSSIVADVNCSYSPCLQVFRLSHNEEMQELNPECFFVPKCRKDYSVAQTIIRNISERLKVHQHFPCYYDPGEGQASVLL-TLLGGALIVALVKLT--QHLSILC......... 190

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 2 0 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Veeramalai M, Ye Y, Godzik A. TOPS++FATCAT: fast flexible structural alignment using constraints derived from TOPS+ Strings Model. BMC Bioinformatics. 2008 Aug 31;9(1):35