current user: public

If you have questions about the server, please let us know.

Query: PF06570.11; Q8DXY5_STRA5/5-213; Protein of unknown function (DUF1129 topsan), from PfamA32U

Results of FFAS03 search in PfamA32U
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .
# Score Template Links and tools%idFirst DLTKKNQEFVHIATNQLLADGKSDAEIKAILEEHLPEIIDNQKKGITARSLLGAPTTWAASFTERPEDKARVSVQKNTNPWLMWLDTSLLFLGLVTALNGLMLLFGQSNVNTGLISILTLGFGGGAAMYVTYYYIYRHMGKPKSERPGWLKSFAVLALVMLVWFALFAVVPLLPATINPKLPEVVLFIIALASFGLRFYLQRKYNIQSSLast
1 -94.200PF06570.11; Q8DXY5_STRA5/5-213; Protein of unknown function (DUF1129 topsan)  ali  100  1DLTKKNQEFVHIATNQLLADGKSDAEIKAILEEHLPEIIDNQKKGITARSLLGAPTTWAASFTERPEDKARVSVQKNTNPWLMWLDTSLLFLGLVTALNGLMLLFGQSNVNTGLISILTLGFGGGAAMYVTYYYIYRHMGKPKSERPGWLKSFAVLALVMLVWFALFAVVPLLPATINPKLPEVVLFIIALASFGLRFYLQRKYNIQSS 209
2 -16.700PF06304.11; A5N334_CLOK5/6-107; Protein of unknown function (DUF1048 topsan)  ali follow..  19ALPEDYQFVFEKIQRYMWNFAGDGYDMLKIQYELIDLFEAGVVEGRQVLEITGEDVAAFCDELLLNAKTYTENWREK.................................................................................................................................... 96
3 -10.700PF08006.11; Q81Y04_BACAN/1-179; Protein of unknown function (DUF1700 topsan)  ali follow..  13  2....SKEQFLKELSSHL--RKLPDEERKDILFDYEEHFQFGIEEGKNESDILGSPKVIAKELLAMYRFDEMKKDPSTSN-----VTRAVMAVIGLSLFNFIIVL----GPLFAIIAFIFSFWVGGIASVVTPFFVIGKVFMGTFIWLDLFVSITFIGVGLLLCIIAYYSTKWFKRLCVRYVIWNFKMIKG................... 179
4 -7.560PF11833.8; K9UNI5_CHAP6/14-205; Protein CHAPERONE-LIKE PROTEIN OF POR1-like  ali follow..  12  1....EDATFIQAAKQRVIAQLGGDRQLQDNIEAAYDAILMERLKLRQQGKIKVPEGIRFPEKLPSAAPKFTSLSVPNSPSWLGDT--SQSQLLTTSGVYTVLGGATLVPSIAYSMLPTILAFGAGFSLYFIN----------QKQRRFKRAVLGTLVALLVGIVVANLLVNYAHLPVNQIGLR---IFAGLLTLILLWVA......... 189
5 -7.210PF15348.6; G1U7G0_RABIT/13-236; Gemini of Cajal bodies-associated protein 8  ali follow..  11  120EITEELRQYFATTEKHREERRRQQQLDAARLEDYVPIERPGARRQAEMKLLYGESAAKIQAMEAAQLSFDKHCNRKLPKYW................................................................................................................................ 217
6 -6.130PF01327.21; DEF1A_SOLLC/88-258; Polypeptide deformylase  ali follow..  17  3DIVKAGDPVLHEPSQDIPLEEIGSERIQKIIEEMVKVMRNAPGVGLAAPQI.............................................................................................................................................................. 53
7 -6.110PF03613.14; Q5WAK6_BACSK/17-280; PTS system mannose/fructose/sorbose family IID component  ali follow..  10  27....QALGYAYSMIPVLKKLYPNPEERAKALKRHLEFF---NSTPQMSTFIMGLSAAMEEKAAKDKEFDADSINSVKVALMVAGIGDSFFWGTFRIIAAGVGVSLASTGNILGAILFLLIFNVPHLLVGTFMGYSKGTTFLNMMYQGGSINRLTYAAGILGLLVIGAMTGTLLQDTLDDILPQALPLGLTFGIY---YMLKKNVK.... 243
8 -6.090PF08627.10; CRTP3_DICDI/55-397; CRT-like, chloroquine-resistance transporter-like  ali follow..  12  71........................................................................................FVIMGLLDAINGFFVVIGGVSTSGPLQQLLNQAIIPFTMIASFIFL----------RERYSLFQLGGAAVILGGVIVSLIPSLVGGSSGGNILFYNFFYLISVIPGALSNVYKDIA..... 176
9 -6.090PF04874.14; M1W484_CLAP2/144-251; Mak16 protein C-terminal region  ali follow..  3...........KIKHREKTRERKAEAAAKLERTIERELVERLRQGAYGDQPLNVSEAIWKKVLNAMEREGECAEDEDMD.................................................................................................................................. 70
10 -6.010PF15682.5; A8E5X0_XENTR/6-80; Musculoskeletal, temporally activated-embryonic nuclear protein 1  ali follow..  16  13.............EEDLKGAKHKLAHQVPIKSKTYQVMQECEQSGTTAPSVFSQNRTGGETAFDKPKEGPAKS........................................................................................................................................ 72

FFAS is supported by the NIH grant R01-GM087218-01
1 3 9 8 0 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Pawlowski K, Jaroszewski L, Bierzynski A, Godzik A. Multiple model approach--dealing with alignment ambiguities in protein modeling. Pac Symp Biocomput. 1997;:328-39.