current user: public

If you have questions about the server, please let us know.

Query: PF06690.11; D7DUD4_METV3/2-259; Protein of unknown function (DUF1188 topsan), from PfamA32U

Results of FFAS03 search in PfamA32U
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .
# Score Template Links and tools%idFirst KYGITENVKTIESKVKVRDIIKKIAEKKANAIKYYLEGEEFEQAIIFGAYLSGNYIANTLKADCGEVILIDSQPHLEDIVTGNGIKFMDLNTFMLKLRNNKDKEINPDLIIDVTGLGGVDPNMLKDFDPKVLIIEDPKSSFDKELMEADNTHKRLCVGHKKGSLKTFRSSKISKTSGTMTLTVDVIMDSCIEIKELDGVLYSVPNLEYFEGIVFHEKDVRKFLREVNTPALTVSCLGNLEAEIDEIIDKNMQKVYSFVLast
1 -88.500PF06690.11; D7DUD4_METV3/2-259; Protein of unknown function (DUF1188 topsan)  ali  100  1KYGITENVKTIESKVKVRDIIKKIAEKKANAIKYYLEGEEFEQAIIFGAYLSGNYIANTLKADCGEVILIDSQPHLEDIVTGNGIKFMDLNTFMLKLRNNKDKEINPDLIIDVTGLGGVDPNMLKDFDPKVLIIEDPKSSFDKELMEADNTHKRLCVGHKKGSLKTFRSSKISKTSGTMTLTVDVIMDSCIEIKELDGVLYSVPNLEYFEGIVFHEKDVRKFLREVNTPALTVSCLGNLEAEIDEIIDKNMQKVYSFV 258
2 -15.600PF13738.6; E4RQY1_LEAB4/3-286; Pyridine nucleotide-disulphide oxidoreductase  ali follow..  10  150.........................................QKIVVIGANNSAVDVALETFRKGADVTMVIRDGEIGRTVKYWVRPDIENRIAEGSIKAYFHSTL----------------KEVREHEVVIHTPEGEVVIDNQWVLAMTGYTPNLSFLEKLGIKL-SEDGKPFYDENTMETNVPGLYLAG.................................................................... 281
3 -12.900PF13450.6; B4RE46_PHEZH/425-493; NAD(P)-binding Rossmann-like domain  ali follow..  35  1.............................................IVGAGFAGSVLAERLSQLGKRVLLVDRRPHV...................................................................................................................................................................................... 32
4 -12.500PF00670.21; SAHH_DICDI/191-351; S-adenosyl-L-homocysteine hydrolase, NAD binding domain  ali follow..  12  24.........................................KVAVVAGYGDVGKGCAQSLSKMGARVLVTEIDP----------INALQACMDGYQIVTMETAAPLSNIFVTTTGCRDVRGEHFAVMKEDAIVCNIGHF....................................................................................................................... 112
5 -11.900PF07992.14; I6L922_STRMU/209-496; Pyridine nucleotide-disulphide oxidoreductase  ali follow..  106.LGAKWRKINVPGEKEFFN-VTYCPHCDGPLFTD-------KKVAVIGGGNSGLEAAIDLAGLASHVYILEFLPELKA---------------DKILQDRAEALDNITILTNVATKEIIGNDHVEGLRYSDRTTNEEYLLDLEGVFVQIGLVPSTDWLKDSGLALNEKGEIIVAKD--GATNIPAIFAAGD................................................................... 272
6 -11.500PF02558.16; Q9K9R6_BACHD/6-154; Ketopantoate reductase PanE/ApbA  ali follow..  10  1...........................................VAVIGSGSIGLLLYAYLKLANWPALLVTNRPEQADHLNKEGLTFVAKSGEHQPISVTATPLSSFSITVKSFAVKALLPQLQRKKWDGLVFFQNG--MTHLEILRQIPARAICCGIVEIGAKRESDVRVQHTGDGAIWIG............................................................................ 145
7 -11.500PF06100.11; G8PAJ4_PEDCP/22-520; MCRA family  ali follow..  14  2.........................................KSAYLVGSGLASLAAATFLVRAGDRIHVLEELGLP...................................................................................................................................................................................... 40
8 -11.500PF02254.18; Q92CZ9_LISMO/5-120; TrkA-N domain  ali follow..  18  2............................................AVIGLGRFGGSICRSLVEQGMEVLAIDSDEERVNEYMSIATHAVIANSTDENALRQLGIR-NFEHVIVAIG---------EDIQSSILTTLILKEMGVKYVTAKATNDKHAKLLDKIGA............................................................................................... 110
9 -11.300PF01946.17; THI4_SCHPO/60-299; Thi4 family  ali follow..  14  5............................TRRYFSDLDKYAESDIVIVGAGSAGLTAAYYIGTRDLKIAIIEASVAP...................................................................................................................................................................................... 54
10 -11.000PF03686.13; Y73A_ARCFU/3-126; Uncharacterised protein family (UPF0146 topsan)  ali follow..  16  1............................MLQIADYIAENYRGKVVEVGIG--FTAVAELLARRGFEVFATDVVERRAP.................................................................................................................................................................................... 49
11 -10.800PF05834.12; LCYB_ARATH/84-479; Lycopene cyclase protein  ali follow..  12  1..........................................DLAIVGGGPAGLAVAQQVSEAGLSVCSIDPSPKVDEFEAMDLLDCLDTTWSGAVVYVDEGVKKDLSR-CITNGVKSKVTNVVHEEANSTVVCSDGVKIQASVVLDATGFSRCLV...................................................................................................... 143
12 -10.100PF05221.17; D9SB20_FIBSS/15-498; S-adenosyl-L-homocysteine hydrolase  ali follow..  11  201TTGVHRLYQMAQAKRLKFPAINVNDSVTKSKFDNLYGCRHSKIAVVCGYGDVGKGCAQSLRGQGARVIITEIDP----------ICALQAAMEGYEVKTLDEVVSYADIFVTTTG-GIISAAQMEKMKNRAIVGNIGHF....................................................................................................................... 345
13 -10.100PF01262.21; Q9S227_STRCO/141-353; Alanine dehydrogenase/PNT, C-terminal domain  ali follow..  11  19...............................LPGGVPGVLAGRAVVIGGGVSGWNAAQIAIGLGFHVTLLDKDITKLREADKIFGTKIQTVVSNAF--ELEKACLEADLVIGAVLIPGVTNELVSRMKPGSVLVD-----------------------------------IAIDQGGCFEDSHPT--THAEPTFPVHNSVF......................................................... 155
14 -9.980PF13434.6; Q4K9A7_PSEF5/9-357; L-lysine 6-monooxygenase (NADPH-requiring)  ali follow..  160.AGGTARVPETFKGLKGDARVFHHSQYLERMASQPCVSGKPMNIAIIGGGQSAAEAFIDLNDSFPSVQADRLVSEYQNTNYSVVDIDLIERIYGIFYRQKVSGIARHTFRTMTTVEKATATDLGIELILRNSASGEREVRHYDAVVLATGYER......................................................................................................... 349
15 -9.960PF13241.6; Q2FTK6_METHJ/4-113; Putative NAD(P)-binding  ali follow..  13  4.....................................DFTGKKVIIFGGGVIGARKARYF-AYEADVLVYSFHPEFQEIPVRTEVCNLTGDLE-----ILRNMIHDASLVIAATSDPELNELIESACAREHIWCNVAAGKRGDVVLPA.............................................................................................................. 110
16 -9.750PF00070.27; AHPF_ECOLI/357-437; Pyridine nucleotide-disulphide oxidoreductase  ali follow..  23  1..........................................RVAVIGGGNSGVEAAIDLAGIVEHVTLLEFAPEM...................................................................................................................................................................................... 34
17 -9.670PF02737.18; Q2YR99_BRUA2/5-183; 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain  ali follow..  13  1..........................................TVGIIGAGQMGSGIAHVCALAGYNVLLHDAAPDRLEKGIATINGNMARQVASGKLQEEQRADAMKLIRPANS----------------------EDLAGVDLAIEAADETIKRKIFAQLCPVLNPEAILATNTS---SISITRLASTTDRPERFIGIHF......................................................... 137
18 -9.390PF03721.14; UGDH_CAEEL/10-205; UDP-glucose/GDP-mannose dehydrogenase family, NAD binding domain  ali follow..  1.........................................SKVVCVGAGYVGGPTCAMIAHKCITVTVVDMNTAKIAEWNSDKLPIYEPGLDEI-----VFAARGRNLFFSSDIPKAIAEADL------FISVNTPTKMYGRGKGMAPDLKYVESVSRTIAQYAGGPKIVVEKSTVPVKAAESIGCILREAQKNNENLKFQVLS..................................................... 156
19 -9.200PF00056.23; MDH_CHLAA/3-142; lactate/malate dehydrogenase, NAD binding domain  ali follow..  20  1.........................................KKISIIGAGFVGSTTAHWLAAKELDIVLLDFVEGVPKALDLYEASPIEGFDVRVTGTNNYADTANSDVIVVTSGA.............................................................................................................................................. 78
20 -9.030PF01266.24; Q89E97_BRADU/6-350; FAD dependent oxidoreductase  ali follow..  22  1..........................................DAIVIGGGIHGCSTTLHLCLAGLKPVLIEKD......................................................................................................................................................................................... 31

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 6 2 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Plewczynski D, Tkacz A, Godzik A., Rychlewski L. A support vector machine approach to the identification of phosphorylation sites. Cell Mol Biol Lett. 2005;10(1):73-89.