Scheduled maintenance will begin on May 30th, 2025. Server will be temporarily unavailable — learn more.
current user: public
If you have questions about the server, please let us know.

Query: PF06855.12; Y467_STRP1/4-70; YozE SAM-like fold, from PfamA32U

Results of FFAS03 search in PfamA32U
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .
# Score Template Links and tools%idFirst SFYSWLMTQRNPKSNEPVAILADLVFDDTTFPKHTNDFELISRYLEDQASFSFNLGQFDEIWEDYLALast
1 -43.700PF06855.12; Y467_STRP1/4-70; YozE SAM-like fold  ali  100  1SFYSWLMTQRNPKSNEPVAILADLVFDDTTFPKHTNDFELISRYLEDQASFSFNLGQFDEIWEDYLA 67
2 -7.450PF11878.8; W5L985_ASTMX/58-168; Domain of unknown function (DUF3398 topsan)  ali follow..  10  8DYESVLVQRKTQILSDVLRDMLQFPIDDFLMSTLRRQGRTLHPTVPEGAEKRATSLFVQECIKTYNS 74
3 -6.790PF10004.9; C7M529_CAPOD/4-162; Uncharacterized protein conserved in bacteria (DUF2247 topsan)  ali follow..  7  100......IVALGKDKTSKLYEV-DMIHSEFDWPI---EWHNFIYYMPPKKGEKMGIDVLYDDLIEYID 156
4 -6.400PF18719.1; A0A0Q3WY42_9BACI/40-166; ArlS sensor domain  ali follow..  5  1.IRQVMLHEEATNISQELSEIINFYKNRPFS--SMEDIQNNSDIIKQLLEKDQTLYVLNQ....... 57
5 -6.320PF18535.1; C5DVB5_ZYGRC/170-250; Gal11 activator-binding domain (ABD1)  ali follow..  12  30............................PNIPPGVNTWQQITELAQQKRLTAQDMQIAKEIYRLHQQ 68
6 -6.010PF15165.6; G1LGN7_AILME/23-259; Meiotic recombination protein REC114-like  ali follow..  25  206.............DAEELGPFLRLCLMDQNFPAFVEDVEKELKKL...................... 237
7 -5.950PF17572.2; Q8B9G6_NPVR1/152-237; Family of unknown function (DUF5478 topsan)  ali follow..  12  7..............................YPSNIDTNEALINFLRPLCATDRTRATYAVPWN.... 39
8 -5.490PF18467.1; A0A0A3IA33_9BACI/4-100; Domain of unknown function (DUF5613 topsan)  ali follow..  17  70..............................FPPNEKVTDEVQTYLSSNNYSIGFLELY......... 97
9 -5.300PF15000.6; A0A0R4IP94_DANRE/1-110; Tumour suppressor candidate 2  ali follow..  16  44....FVFTRRSSLYFDEDGDLAHEFYEETVVTKNGRKKAKLKRIQKN.................... 86
10 -5.160PF15182.6; F7EZI1_ORNAN/21-88; Otospiralin  ali follow..  17  26DFWSYVEYFRTLGAYQQINDMARTFFS--HYPLGNT............................... 59
FFAS is supported by the NIH grant R01-GM087218-01
1 4 8 0 6 6   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Pawlowski K, Pio F, Chu Z, Reed JC, Godzik A. PAAD - a new protein domain associated with apoptosis, cancer and autoimmune diseases. Trends Biochem Sci. 2001 Feb;26(2):85-7.