current user: public

If you have questions about the server, please let us know.

Query: PF07122.11; Q2GHT8_EHRCR/101-130; Variable length PCR target protein (VLPT), from PfamA32U

Results of FFAS03 search in PfamA32U
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30
# Score Template Links and tools%idFirst DLQQSSNSDLHESSFVELPGPSKEEVQFEDLast
1 -30.900PF07122.11; Q2GHT8_EHRCR/101-130; Variable length PCR target protein (VLPT)  ali  100  1DLQQSSNSDLHESSFVELPGPSKEEVQFED 30
2 -5.670PF04272.14; X1WCE4_DANRE/1-52; Phospholamban  ali follow..  23  4.VQHMTRSAIRRASNIEVNPQTKRNLQ... 29
3 -5.290PF05083.13; LST1_HUMAN/16-96; LST-1 protein  ali follow..  50  32..QGSSEQELHYASLQRLPVPSSE...... 53
4 -4.770PF06481.14; H2IZJ2_RAHAC/239-284; COX Aromatic Rich Motif  ali follow..  17  1..KSAPNQLATTDDFNKLAVQSIDN..... 23
5 -4.250PF18104.1; H2T5W4_TAKRU/918-952; Jumonji domain-containing protein 2A Tudor domain  ali follow..  27  5.ICKHKNGRYYNSEVQELSPTTFYEVVFDD 33
6 -3.590PF12885.7; H2TTK8_TAKRU/175-336; Transducer of regulated CREB activity middle domain  ali follow..  41  1..RTNSDSALHTSV................ 12
7 -3.260PF18115.1; A0A0U1LVM9_TALIS/906-955; DNA repair protein Crb2 Tudor domain  ali follow..  14  10...NGLTRSYYPARFLRAVGHQRCILKFTD 36
8 -3.190PF06984.13; Q9XZY7_LEIMA/13-101; Mitochondrial 39-S ribosomal protein L47 (MRP-L47)  ali follow..  27  26SLRRKSLADLQQIWLSLL............ 43
9 -2.920PF17886.1; A9WBH2_CHLAA/329-391; HSP20-like domain found in ArsA  ali follow..  14  8...............IRLPFADVSQLDLY. 21
10 -2.780PF01119.19; A5CFB6_ORITB/216-334; DNA mismatch repair protein, C-terminal domain  ali follow..  60  93....................PTKSEVRFHD 102

FFAS is supported by the NIH grant R01-GM087218-01
1 3 9 8 0 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Pawlowski K, Jaroszewski L, Bierzynski A, Godzik A. Multiple model approach--dealing with alignment ambiguities in protein modeling. Pac Symp Biocomput. 1997;:328-39.