current user: public

If you have questions about the server, please let us know.

Query: PF07660.14; A6C2R4_9PLAN/303-351; Secretin and TonB N terminus short domain, from PfamA32U

Results of FFAS03 search in PfamA32U
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .
# Score Template Links and tools%idFirst LNILTGQGVTGTISANLKNVTPAQALDAILRSRDLTSEKEGEFIYVMTQLast
1 -38.100PF07660.14; A6C2R4_9PLAN/303-351; Secretin and TonB N terminus short domain  ali  100  1LNILTGQGVTGTISANLKNVTPAQALDAILRSRDLTSEKEGEFIYVMTQ 49
2 -6.360PF11983.8; B9DUV4_STRU0/377-454; Membrane-attachment and polymerisation-promoting switch  ali follow..  20  1VDVLAQSAVSGEELLRRKPVDFSGQESYI.................... 29
3 -4.740PF14321.6; A1TYG0_MARHV/32-178; Domain of unknown function (DUF4382 topsan)  ali follow..  12  1.........TGSVSVGLTDAPTMELSSVNIAFNAIRLKPADG....... 33
4 -4.710PF14950.6; SPIDR_HUMAN/11-369; Domain of unknown function (DUF4502 topsan)  ali follow..  12  330LKVLFTKETAGYLRGRPQDTPWQKL........................ 359
5 -4.600PF16056.5; B4JX46_DROGR/64-449; Domain of unknown function (DUF4799 topsan)  ali follow..  42  177.............STQMGDVTLERMIDAILES................. 195
6 -4.570PF07405.11; Q9R2M2_BORBU/1-127; Protein of unknown function (DUF1506 topsan)  ali follow..  16  104FEIFSIDSSIGYFTLVLKEFIWTN......................... 127
7 -4.480PF17509.2; S6JGW7_PSEST/78-170; Family of unknown function (DUF5440 topsan)  ali follow..  28  14LHVVSHKGMTGNKSWVLRDLATDQAYEL..................... 41
8 -4.440PF06964.12; E6K2X7_PARDN/299-503; Alpha-L-arabinofuranosidase C-terminal domain  ali follow..  12  120INAVAVRGCNGNLEIFATNRSLTDDVEFTIQNFDENQPKVILASTLHED 168
9 -4.180PF10819.8; C5DA01_GEOSW/8-84; Protein of unknown function (DUF2564 topsan)  ali follow..  18  10MFVETAEKMVGQATMSLDRDMLEGAKQAIANAH................ 42
10 -4.070PF11276.8; D5BEP3_ZUNPS/38-130; Protein of unknown function (DUF3078 topsan)  ali follow..  12  16.SISALFHGQFERNYKKKLTSWKNYLSLLNSQEGQELRKTDDQIQFKTT 66

FFAS is supported by the NIH grant R01-GM087218-01
1 3 9 8 0 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Pawlowski K, Jaroszewski L, Bierzynski A, Godzik A. Multiple model approach--dealing with alignment ambiguities in protein modeling. Pac Symp Biocomput. 1997;:328-39.