current user: public

If you have questions about the server, please let us know.

Query: PF07741.13; M2QT23_CERS8/458-559; Brf1-like TBP-binding domain, from PfamA32U

Results of FFAS03 search in PfamA32U
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100
# Score Template Links and tools%idFirst LGLDEEELDQFLLTEEEVRIKERVWVEMNLDYLEAIAAKSEQQAEAEAKEKKSRKRRKTSNKPRDASTPHGSTAAESVRNLIKKNPKYSKRINYDALKDLFDLast
1 -69.000PF07741.13; M2QT23_CERS8/458-559; Brf1-like TBP-binding domain  ali  100  1LGLDEEELDQFLLTEEEVRIKERVWVEMNLDYLEAIAAKSEQQAEAEAKEKKSRKRRKTSNKPRDASTPHGSTAAESVRNLIKKNPKYSKRINYDALKDLFD 102
2 -6.910PF15519.6; M0SUN8_MUSAM/284-379; linker between RRM2 and RRM3 domains in RBM39 protein  ali follow..  12  1..FDDEDGGGLSLNAR------------SRAILMQKLDRTGAASSIAESLGVPIINGAVPNQHAFGLLANGRSMSPAVVSAQHTPTSVVEPSECLLLKNMFD 88
3 -6.610PF10532.9; Q9LRP4_ARATH/53-166; Plant specific N-all beta domain  ali follow..  12  30..RDDDDVYVYLTTLDEEKSRSVLHVEVGNELEMVDVNEQQSRVQRKSS..................................................... 76
4 -6.450PF04109.16; ATG9_ASPFU/209-698; Autophagy protein Apg9  ali follow..  18  116LGVSDTDIQTI-------------WQEIVSRLMTLRDANPATAGAVSARHRKFMGSQSKQR-----------DAHDIANRLMRKENYLIALINKDILD.... 191
5 -6.420PF03896.16; B0XFI4_CULQU/3-291; Translocon-associated protein (TRAP), alpha subunit  ali follow..  12  235.............VRKTVETGTTNTKDVDYEWIPAETLKKIQNSPKGGKVSPKQSPRQRKAKRAVGD................................... 288
6 -6.390PF10982.8; M1FHI5_9ALTE/1-75; Protein of unknown function (DUF2789 topsan)  ali follow..  23  15LGLDDASMEEFVLPPEVVLADAGFWSLGQSQFLREGLESDSD............................................................ 63
7 -6.030PF11040.8; Q4CUC2_TRYCC/379-465; Dispersed gene family protein 1 of Trypanosoma cruzi C-terminus  ali follow..  17  1........................WYAEDRHWQELREPRRGGLEALLRDGEDGDEEMQKPHNVTSSSYTSGTTAASSYRPPAQPLQPVAGDTRSDALSLL.. 76
8 -5.780PF15150.6; APR_CANLF/1-54; Phorbol-12-myristate-13-acetate-induced  ali follow..  16  4...........................................................RKARKSAQPGPTRAPEELEVECAIQLRKFGDKLNFNLLSKLF. 50
9 -5.730PF11047.8; SOPD2_SALTY/1-319; Salmonella outer protein D  ali follow..  10  15..INHSRLARLMSPDKEEALYMGVWDRF-KDCFRTHKKQEVLEVLYT-----------------------IHGCERENQAELNVDITGMEKIHFTQLKEY.. 90
10 -5.690PF10231.9; APOP1_BOVIN/52-180; Apoptogenic protein 1  ali follow..  16  25...SPLEQKLRELRQETQEWNQQFWADQNLTFHKEKEEFVRSRLKAKGLDLRTASGQKAT--------LNAEEMAEFYKEFLSKNFQKHMYYNRD....... 108

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 2 0 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Veeramalai M, Ye Y, Godzik A. TOPS++FATCAT: fast flexible structural alignment using constraints derived from TOPS+ Strings Model. BMC Bioinformatics. 2008 Aug 31;9(1):35