current user: public

If you have questions about the server, please let us know.

Query: PF07837.12; R6RB74_9CLOT/5-181; Formiminotransferase domain, N-terminal subdomain, from PfamA32U

Results of FFAS03 search in PfamA32U
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .
# Score Template Links and tools%idFirst LIECVPNYSEGRDLEKIEKIVECFRAKKGVRLLDYQTDPNHNRLVVTVIGEPEPLRDAVVASFGRAVELIDMTKHEGQHPRMGAVDVVPFIPCRNATLEEADALAKEVAKTVGEQYGIPCFLYESSATAPHRANLASIRKGQFEGMAEKMQDTEKWAPDFGPAAPHPTAGVSAVGARLast
1 -102.000PF07837.12; R6RB74_9CLOT/5-181; Formiminotransferase domain, N-terminal subdomain  ali  100  1LIECVPNYSEGRDLEKIEKIVECFRAKKGVRLLDYQTDPNHNRLVVTVIGEPEPLRDAVVASFGRAVELIDMTKHEGQHPRMGAVDVVPFIPCRNATLEEADALAKEVAKTVGEQYGIPCFLYESSATAPHRANLASIRKGQFEGMAEKMQDTEKWAPDFGPAAPHPTAGVSAVGAR 177
2 -6.820PF12867.7; A9B650_HERA2/29-177; DinB superfamily  ali follow..  46FGHLICHVTSS-NEEAALTALAMASGILPNERLRYETPWRDLQTLEQARQRLEESRRMCLSMLDAWPDQPHLEISKVLYEAWGPLNAHGRYFL.................................................................................... 137
3 -6.070PF05853.12; A5V8P7_SPHWW/3-299; beta-keto acid cleavage enzyme  ali follow..  12  226.........................................................SVLGGGRHQMPIATMSAAMGGNVRVGLEDSLQLATSNAEQVRRIRTVLEALSLEVATPDEARAML....................................................... 295
4 -5.950PF03361.14; VIE2_HCMVM/383-543; Herpes virus intermediate/early protein 2/3  ali follow..  13  29....QIIYTRNHEKNEVDQVRCRLGSMCNLALSTPFL-MEHTMPVTHPPDVAQRTADACNDGVKAVWNLKELHTHQ---PRSSDYRNMIIHAATPVDLLGALNLCLPLMQKFPKQVMVMLPIYETAAK................................................. 161
5 -5.850PF10972.8; Q5QU42_IDILO/13-358; Peptidoglycan-binding protein, CsiV  ali follow..  14  250........TAAGNPQLAWEFDGLMHIFLVGNYLHIDGEFNLREQDKIKRIANDLETQAAYALFSQLRRVISHETHYFDHPKLGVV--VQIRRT.................................................................................... 346
6 -5.610PF14331.6; K4KGH7_SIMAS/197-457; ImcF-related N-terminal domain  ali follow..  21  15.......................................................................LKRHRRRRPINGAILAISLQDLMVQTAEQRTHQAKTLRTRINEGIRFPIYLT...................................................... 71
7 -5.490PF01553.21; GPAT9_ARATH/153-274; Acyltransferase  ali follow..  15  10..........................................RPKQVYVANHTSMIDFIVLEQMTAFAVIMQKHPGWVGLLQSILESVGCIWFNRSEAKDREIVAKKLRDHVQGADSNPLLIFPEG-TCVNNNYTVMFKKGAFE................................. 111
8 -5.480PF05874.11; PBAN_BOMMO/8-191; Pheromone biosynthesis activating neuropeptide (PBAN)  ali follow..  25  149...............................................................................PRLG----MSFSPRLGRELSYDYPTKYRVARSVNKTMD............................................................ 184
9 -5.430PF06239.11; ECSIT_MOUSE/45-266; Evolutionarily conserved signalling intermediate in Toll pathway  ali follow..  10  48AVRSFGAHNVRKR----GHVDFIYLALRKMPEFGVERDLSVYNLLLDVFPKEVFRPRNVIRQQECGVAVLEQMERHGVMPSAETEFLL-PYPVPRDLPQDPLDLAKLGLRHMEPDLSAKVTVYQMGMEDPTQPHI.......................................... 220
10 -5.390PF01446.17; A0A0C1NIB9_9CYAN/69-306; Replication protein  ali follow..  18...CQWRRALMWKAKAYKILPQVVADYPKYRWLFITLTVKNCQI--ELRTTLDGINKAFKRLTELWVKSVEVRDGMSAHPHLHIL............................................................................................ 109

FFAS is supported by the NIH grant R01-GM087218-01
1 3 8 7 1 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Friedberg I. and Godzik A Connecting the Protein Structure Universe by Using Sparse Recurring Fragments. Structure (Camb.) (2005) Aug;13(8):1213-24