current user: public

If you have questions about the server, please let us know.

Query: PF07983.13; C5FFH9_ARTOC/395-475; X8 domain, from PfamA32U

Results of FFAS03 search in PfamA32U
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80
# Score Template Links and tools%idFirst ITCRAKSTVHDEDLSRLFSTVCGLSPMACEDIASNATSGIYGMYGMCNPIDQLSWAFNAYYEDQVKKGNGDTACHFGGAASLast
1 -63.300PF07983.13; C5FFH9_ARTOC/395-475; X8 domain  ali  100  1ITCRAKSTVHDEDLSRLFSTVCGLSPMACEDIASNATSGIYGMYGMCNPIDQLSWAFNAYYEDQVKKGNGDTACHFGGAAS 81
2 -7.270PF14196.6; R5VKP4_9FIRM/52-197; L-2-amino-thiazoline-4-carboxylic acid hydrolase  ali follow..  20  96..CGACKLCQDEGCPELAAYICRMDYVLAE-------------------------IMHMKLVRTGTIAEGAPYCDF..... 144
3 -5.690PF15989.5; B4K3K9_DROGR/59-146; Domain of unknown function (DUF4768 topsan)  ali follow..  15  23LPC----DLDQSGRAQIVSSF----PNHCIWVWNNKYAHE-GTFRVYKTYQLEAFFFGQYYERLKRFEIDPHTWD...... 88
4 -5.640PF04932.15; Q7UWZ2_RHOBA/233-380; O-Antigen ligase  ali follow..  21  103..............................GSGISTYGYSYLPYQSQSPGPWFEHADNLWLEMLVETG............. 140
5 -5.470PF07884.14; B7G622_PHATC/87-217; Vitamin K epoxide reductase family  ali follow..  14  9AGMIETAYLTLTKLTDKVDILCGADG-GCSSILNGPYAFIPGTNIPLSLLGFVAYAT........................ 64
6 -5.400PF16082.5; D0IZ12_COMT2/1-76; Bacteriophage holin family, superfamily II-like  ali follow..  18  1...MKNETIELMASAGNRTTGGGAIVSFFGWVASSNAIGILGL-----AVAIIGALVNWYYKREANR.............. 59
7 -5.400PF04784.14; F6HQJ4_VITVI/367-502; Protein of unknown function, DUF547 topsan  ali follow..  14  89....ERKAYGIEHPEPLLHFALCSGSHSDPSAR---------IYTPKNVFQELEVAKEEY..................... 135
8 -5.340PF17497.2; Q0NCS4_VAR65/1-74; Family of unknown function (DUF5432 topsan)  ali follow..  20  16..........................ESCSSIHLLSLHPLYVIMSPMDI-----IGFNKYFRYRNK............... 50
9 -5.330PF07800.12; I1PLP2_ORYGL/49-202; Protein of unknown function (DUF1644 topsan)  ali follow..  10  2ATCSICLEHP----HKAVLLLCSSHSKGCRPYMCDTNRQHSNCLEQFKNAYSRGKPACELFLNRKRRTCMHEGCSFGGS.. 112
10 -5.320PF16080.5; J7U231_MORMO/5-60; Bacteriophage holin family HP1  ali follow..  14  1...........DKYSSPTAYAWGLITSAFGILSLDQWAIVAGI-----ICTVGTFLVNWYYKRKEFQLKAGE......... 56

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 6 1 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Friedberg I. and Godzik A Connecting the Protein Structure Universe by Using Sparse Recurring Fragments. Structure (Camb.) (2005) Aug;13(8):1213-24