current user: public

If you have questions about the server, please let us know.

Query: PF07991.12; ILVC_METAC/15-178; Acetohydroxy acid isomeroreductase, NADPH-binding domain, from PfamA32U

Results of FFAS03 search in PfamA32U
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160
# Score Template Links and tools%idFirst LKDKTIAIMGYGSQGHAHARNLHESGLNVVVGLRKGSSSWAKAESDGLKVMTVEEAAKAADVIMILLPDEKQASVYYSQIEPSLEAGNALVFAHGFNIHYNQIVPPKDVDVFMVAPKGPGHIVRRTYTEGIGVPGLIAVYQDATGKARDLALAYAKGIGATRAGLast
1 -71.200PF07991.12; ILVC_METAC/15-178; Acetohydroxy acid isomeroreductase, NADPH-binding domain  ali  100  1LKDKTIAIMGYGSQGHAHARNLHESGLNVVVGLRKGSSSWAKAESDGLKVMTVEEAAKAADVIMILLPDEKQASVYYSQIEPSLEAGNALVFAHGFNIHYNQIVPPKDVDVFMVAPKGPGHIVRRTYTEGIGVPGLIAVYQDATGKARDLALAYAKGIGATRAG 164
2 -36.600PF03446.15; Q8FTI1_COREF/15-184; NAD binding domain of 6-phosphogluconate dehydrogenase  ali follow..  15  1....QIGVVGLAVMGSNLARNFARNGHTVAVYNRSTDKTDKLISDYATDTKTVEDFVAALEKPRRAIVMVQAGAATDAVI-----NQLADAMEEGDIIIDGGNALYTDTVCREKEMAARGRHFVGAGISGGEEGALPSIMPGGPKESWEALGPLLESIAA.... 158
3 -21.000PF00670.21; SAHH_DICDI/191-351; S-adenosyl-L-homocysteine hydrolase, NAD binding domain  ali follow..  18  21IAGKVAVVAGYGDVGKGCAQSLSKMGARVLVTEIDPINALQ-ACMDGYQIVTMETAAPLSNIFVTTTGCR---DIVRGEHFAVMKEDAIVCNIGH..................................................................... 111
4 -20.500PF10727.9; Q743Y6_MYCPA/8-128; Rossmann-like domain  ali follow..  20  3.ARLKVGIISAGRVGTALGVALERADHVVVCSAISHASRQRAQRRPDTPVATPPEVAAGAELLLLAVPDSELAGLVSGAATEAVRAGTIVAHTSG..................................................................... 99
5 -16.200PF03807.17; Q21544_CAEEL/2-98; NADP oxidoreductase coenzyme F420-dependent  ali follow..  18  1....KIGFIGAGKMAQALARGLINSGRNIIASSPKRDEVFLDQCKGLNTTHDNAEVVQKSDVVFLAVKPVHVSKVASEIAPALSKEHLVVSIALG..................................................................... 97
6 -16.200PF01210.23; GPDA_COXBU/7-162; NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus  ali follow..  18  1....PIAILGAGSWGTALALVLARKGQKVRLWSYESDHVDEMQAETLKAYCDLKASLEGVTDILIVVPSFAFHEVITRMKPLIDAKTRIAWGTKGL.................................................................... 106
7 -15.000PF05221.17; D9SB20_FIBSS/15-498; S-adenosyl-L-homocysteine hydrolase  ali follow..  18  254MAGKIAVVCGYGDVGKGCAQSLRGQGARVIITEIDPICALQ-AAMEGYEVKTLDEVVSYADIFVTTTGNT---GIISAAQMEKMKNRAIVGNIGHF.................................................................... 345
8 -14.900PF02826.19; Q98GE4_RHILO/107-283; D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain  ali follow..  16  36LAGKTIGIVGLGAVGQAVGHIAAHGDLKVVATTRSMQP-----APEKVGFLSIDALVEQSDIIVLCCPLTPETRGLIERIARMKPNALLINVSRGPVVDDDALIEALREGRIGGA................................................. 148
9 -14.800PF01488.20; HEM1_PSEAE/169-304; Shikimate / quinate 5-dehydrogenase  ali follow..  20  10LHRSQALLIGAGETITLVARHLFEQGVRIVVANRTLERASLLAEQHAVLLSEIPEELANSDIVISSTASQLPI........................................................................................... 86
10 -14.100PF02558.16; Q9K9R6_BACHD/6-154; Ketopantoate reductase PanE/ApbA  ali follow..  13  1.....VAVIGSGSIGLLLYAYLKLANWPALLVTNRPEQADHLNKEG--ATPLSSFSAEEAEVGFITVKSFAVKALL--PQLQRKKWDGLVFFQNGM.................................................................... 103
11 -13.700PF02737.18; Q2YR99_BRUA2/5-183; 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain  ali follow..  12  1....TVGIIGAGQMGSGIAHVCALAGYNVLLHDAAPDEEQRADAMKLIRPANSMEDLAGVDLAIEAATEDETIKKIFAQLCPVLNPEAILA----------TNTSSISITRLASTTDRPERFIGIHFMNPVPVMKLVELVRGTEEDTFRKSNDFVTALGKTVT. 175
12 -13.200PF02254.18; Q92CZ9_LISMO/5-120; TrkA-N domain  ali follow..  14  1.....FAVIGLGRFGGSICRSLVEQGMEVLAIDSDEERVNEYMSINSTDENALRQLIRNFEHVIVAIGEDIQSSILTTLILKEMGVKYVTAKATN..................................................................... 98
13 -13.000PF10100.9; H6NF63_9BACL/6-429; Staphylopine dehydrogenase  ali follow..  10  1...NRVLILGTGPASVQLAVTLKNKWNCIGIAGRESVRSEPFFTA-DHVFQGYGTITGEWDTLILAVTTDAYVAVLKQIHGELLKRVRCMLLLSP..................................................................... 118
14 -12.200PF01262.21; Q9S227_STRCO/141-353; Alanine dehydrogenase/PNT, C-terminal domain  ali follow..  18  26VLAGRAVVIGGGVSGWNAAQIAIGLGFHVTLLDKDITKLREADKIFGSNAFELEKACLEADLVIVLIPGAKAPKLVTNELVSRMKPGSVLV......................................................................... 125
15 -12.000PF00389.30; Q9KCG9_BACHD/20-325; D-isomer specific 2-hydroxyacid dehydrogenase, catalytic domain  ali follow..  20  132LRGKTLGIIGFGRIGSQIAKRAKAFEMTPYVFDPFLTK--ARAEKLGVTVASLDDVLQVADIITVHTPLTKETKGLLMKNIGKTKKGVFLINCARGGIIDEE-------------------ALKHYLREGHIAGAALDVFEE...................... 253
16 -11.600PF03721.14; UGDH_CAEEL/10-205; UDP-glucose/GDP-mannose dehydrogenase family, NAD binding domain  ali follow..  13  1...SKVVCVGAGYVGGPTCAMIAHKCPHITVTVVDMNTAKAARGRNLFFSSDIPKAIAEADLIFISVNTPTKMYGRGKGMAPDLKRTIAQYAGGPKIVVEKSTVPVKAAESIGCILRE.............................................. 142
17 -11.400PF00056.23; MDH_CHLAA/3-142; lactate/malate dehydrogenase, NAD binding domain  ali follow..  18  1...KKISIIGAGFVGSTTAHWLAAKELDIVLLDFVEGVPQGKAFDVRVTGTNNYADTANSDVIVVTSGNADITRACISQAAPLSPNAVIIMVNNPLDAM................................................................. 123
18 -11.200PF13380.6; B9JVC9_AGRVS/19-138; CoA binding domain  ali follow..  15  1...KIIALTGASRPSHGVMHFLLNHGYRVIPVN---PGQAGKDILRQTVFASLGDIPEPVDMIDVFRASEYLPAVVDEALGLKHLPKVI........................................................................... 87
19 -10.600PF13460.6; G2TRC2_BACCO/7-191; NAD(P)H-binding  ali follow..  16  2.........ANGKIGKILVDLLQKSDRHIRAMVRKEEQAQFFRQKGVDAVDELAEAAKGCDIVFTAGSGGHTDKTLAVKTMEAAEKAGI........................................................................... 88
20 -10.200PF03720.15; A1RC15_PAEAT/319-420; UDP-glucose/GDP-mannose dehydrogenase family, UDP binding domain  ali follow..  20  1......AILGVTSPALDIANKLFDEGAEVTVYDPAGNVNASRRSPQHHYVTSMGDAVKNADLILLLTEWDEFKTLTPEGLAAQTGTRKII.......................................................................... 94
21 -10.200PF04016.12; A2SQA8_METLZ/104-244; Putative heavy-metal chelation  ali follow..  15  11.AGKTVALVGH-----PFIQKLRERVENLQVLEIHP-------GEDEYPKEAAAEIIPRADVVG--ITGSSLVNHTMDGLLDLCDPNALVIVL-GPTTPLSPVMFEHGADIIAGSRVIDGKSVLAAVGQGAS................................ 127
22 -10.100PF02629.19; SUCA_CAEEL/31-124; CoA binding domain  ali follow..  19  2.KDTKVIVQGFGKQGTFHGKQMLEYNTKVVGGVNANKAGTEHLGLPVFKNVSEARNKTGADASVIYVPASAAGSAIEEAMDAEIP--LVVCITEG..................................................................... 94
23 -9.760PF02423.15; Q2YIG4_BRUA2/15-320; Ornithine cyclodeaminase/mu-crystallin family  ali follow..  15  121.NARTMAIIGNGAQSEFQALAFKAI--KLRLYDLDPQATAKCIRNNIVACKSVEEAVEGADIITTVTADKANATILTDN----VGAGVHINAVGGDCSGKTELHGDRRSDIFVEYPPQTRIEGEIQQLPEDYPVNELWEVITGRGRKDARQITLFDSVGFA... 289
24 -9.580PF16924.5; D3E6N7_GEOS4/7-123; Dipicolinate synthase subunit A N-terminal domain  ali follow..  14  3.......FVGGDARQIEVIRKCAEMDASVMIAGFEKLQD---SFQGVTREPLTPELLSDADALILPVVDEGRVSALFSEGPLRLQEEHIAAMPGHGVIY................................................................. 94
25 -9.250PF02882.19; FOLD1_ARATH/184-349; Tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding domain  ali follow..  12  36IAGKNAVVIGRSNVGLPMSLLLQRHDATVSTVHAFTK--------------DPEHITRKADIVIAAAGIPNLVRG------SWLKPGAVVIDVGTTPVEDSSCEFGYRLVGDVCYEEALGVASAITPVPGGVGPMTITMLLCNTLEAAKR.............. 166
26 -9.230PF01225.25; MURC_RHOPA/9-108; Mur ligase family, catalytic domain  ali follow..  23  2.....IHFVGIGGIGSGIAEVLCNLGYTVQGSDASESANVNRLREKGIQIH--ADNIKGADVLVV................................................................................................... 64
27 -9.210PF08643.10; YBL3_SCHPO/91-337; Fungal family of unknown function (DUF1776 topsan)  ali follow..  1.QKTQVVVLSAWNLASVIAHDLDRRGFIVVVLVRDASEAATVSLQQ------------RPYIQSLIVTHNEAVERFLLSFSNQSGPKEYALRLRGLILVPTGDSLYTPIENIGKDAWISAFQQLSESFS---VSRMIPLLKSQKARIIGLSHGILSAYE..... 145
28 -9.110PF00899.21; SAE2_HUMAN/11-443; ThiF family  ali follow..  10  5VAGGRVLVVGAGGIGCELLKNLVLTGFHIDLIDLDTIDVSNLNRQFLFQKKHVGR--SKAQVAKESVLQFYPKANIVAYHDSIMNPDYNVEFFRQFILVMNALDNRAARNHVNRMCLAADVPLIESGTAG--YLGQVTTIKKGVTECYE............... 150

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 6 2 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Plewczynski D, Tkacz A, Godzik A., Rychlewski L. A support vector machine approach to the identification of phosphorylation sites. Cell Mol Biol Lett. 2005;10(1):73-89.