current user: public

If you have questions about the server, please let us know.

Query: PF08045.11; E9DYC2_METAQ/1-287; Cell division control protein 14, SIN component, from PfamA32U

Results of FFAS03 search in PfamA32U
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .
# Score Template Links and tools%idFirst MEALLSLAFDNLSSYDGPKVRKGLRQVEGLLAQICLSDGRAAAQRRQSCVDGEADAPLSPPRKDLGELSQDPAFREFFKLQEGFEWNVAMRLIRTLDRLMAKGSDGQNDLLILSALDLIQGVLLLHPPSKTLFSREQNMNLLLDLLEPFNCPAIQSATLLTLVVALIDTPSNTRTFEGLDGLLTVTSLFKSRSTSREVKLKLVEFLYCYLMPETPSIPRADQRDSVPAMLQRSPSKLAGAFNAESRRKRAGSSGLVTLTTEEKQELLSRHLSSVEDLVKDLKNCAPFLast
1 -96.000PF08045.11; E9DYC2_METAQ/1-287; Cell division control protein 14, SIN component  ali  100  1MEALLSLAFDNLSSYDGPKVRKGLRQVEGLLAQICLSDGRAAAQRRQSCVDGEADAPLSPPRKDLGELSQDPAFREFFKLQEGFEWNVAMRLIRTLDRLMAKGSDGQNDLLILSALDLIQGVLLLHPPSKTLFSREQNMNLLLDLLEPFNCPAIQSATLLTLVVALIDTPSNTRTFEGLDGLLTVTSLFKSRSTSREVKLKLVEFLYCYLMPETPSIPRADQRDSVPAMLQRSPSKLAGAFNAESRRKRAGSSGLVTLTTEEKQELLSRHLSSVEDLVKDLKNCAPF 287
2 -20.500PF16782.5; J8Q2G5_SACAR/122-421; Nucleotide exchange factor SIL1  ali follow..  6.............................................SNDFKEIRSIFDSHSTLSSHDITVLEDKFDNVMEFAHDYKHGYKIIVHEFPLLANVSLNENLSLTLRELSTRVITSCMRNNPPVVEFIDERGFKGQVILALSHKFSNILIKRYLSILNELP-VTSQDLPIYSTINLQNVYQRNGKD----KQLQIKVLELISKILKTGVRKNEDPDEVLYKRNVQKWSPDLQ------------ANEFQAMAQDKEIDELHMRTFFDTLYNLKSIFKS.... 236
3 -20.100PF17822.1; G3S7I6_GORGO/1-229; Family of unknown function (DUF5584 topsan)  ali follow..  13  65...........................................................LMNESLPIEKRAQAAQKIGLLAFTGGPPAGNFAAEYMEEVAHLLQDEELAPKIILLLQSVACWCYLNPVSQKRAKSLQFIPILISFFEGRFESTLKFWTCYVLSVMTCNNLSCVKELKDHSALKYHLQMLAAEN--SGWTENFAEVLYFLI............................................................................. 225
4 -13.300PF17741.1; A0A151PBS4_ALLMI/1-268; Family of unknown function (DUF5578 topsan)  ali follow..  12  47...............................................................................LELEFSQGASLFLARLTAWLRLSYMNGTCLDQLLKAIGIFLSAA-SGHRYLIEFLEVGGVLTLLEILGLSQKEEDKKESIKLLQLVANAGRKYKELICESYGVRSIAEFMASSK-SEKAQRQVQILLDSLGHGNPKPCTSPHAQQLSLQTLRVVQAIVGKSHPSIVEAVLGVLRSMELEVQYEAIQLIKDLTSYLRGLVALLK---P. 268
5 -12.500PF11698.8; K5XHD3_AGABU/314-430; V-ATPase subunit H  ali follow..  12  40......................................................................................................................................EHEQLKKLINLLRSSDDPNILAIAANDVGQYVKHYERGKKFVTDMGGKDRVMELMAHT--NPEVRYRALLSVQQLVSQS.......................................................................... 116
6 -12.500PF05804.12; KIFA3_HUMAN/13-720; Kinesin-associated protein (KAP)  ali follow..  387YKQIAMCVLYHISMDDRFKSMFAYTDCIPQLMKMLFECSDERIDLELISF----CINLAANKRNVQLICEGNGLKMLMKRALKFKDPLLMKMIRNISDLAAQISNDEEEEFVIECLGTLANLTIPDLDWELVLKEYKLVPYLKDKLKPGAAEDDLVLEVVIMIGTVSMDDSCAALLAKSGIIPALIELLNAQQEDDEFVCQIIYVFYQMVFHQATRDVIIKETQAPAYLIDLMHDKNNEIRKVCDNTLDIIAEYDEEWAKKIQSEKFRWHNSQWLEMVESRQM.... 680
7 -11.700PF04826.13; ARMX3_MOUSE/110-363; Armadillo-like  ali follow..  19  1.............................................................................................................................SPNSDDTVLSPQELQKVLCLVEMSEKPYILEAALIALG--NAAYAFNRDIIRDLGGLPIVAKILNTRD--PIVKEKALIVLNNLSVNAE-------NQRRLKVYMNQVCDDTVTSRLNSSVQLAGLRLLTNMTVTNEYQHILANSISDFFRLFSA....... 145
8 -11.500PF03224.14; VATH_ORYSJ/2-323; V-ATPase subunit H  ali follow..  14  188........................................................................CLATLLREQYVRALFVQADGVKLLIPLISPASTQQSIQLLYETCLCIWLLSF-YDAAVDYLSTTRVMPRLVEVVKGSTKEKVVRVVIMSIRN-LLAKGAFAAQMIDLGLPHIVQNLKAQAWTDEDL-LDALNQLEIGL............................................................................. 322
9 -11.400PF09759.9; Q5BC22_EMENI/804-903; Spinocerebellar ataxia type 10 protein domain  ali follow..  12  5..................................................................................................................VVLVLSSLVWKCPEVQDQIRRYGGVETILSCTNFDHNPYIKEHAVMCLKFLLEGNRENQKLIEELEAREVRNGMLQQRGLTGKLAIR...................................................................................... 100
10 -10.800PF15787.5; B4GTF6_DROPE/27-302; Domain of unknown function (DUF4704 topsan)  ali follow..  12  6.....................................................................................................................MLQDVKAVVTHSHCTLNSIGGIQVLFPLFDIKRDPSLCSKLLGFICELVETSQTVQQHMIQNRGFLVISFMLQRSS-REHLTLEVLGSFLNLT............................................................................. 109
11 -10.700PF10508.9; A7SP09_NEMVE/2-505; Proteasome non-ATPase 26S subunit  ali follow..  10  46....SERLFNCLRTTNTDQITYCKNILKNILKDAVIEGLNHPTEDVRELCLIELERCSGTVNGVLALMDKEDLLSYIARGMADEHLKNAQIASNVFTNLAKHEAGKTKDTVRMRVYDMYITVQAHSPKAFDVCKESGIFEKLISELD-GRDVLVQMNCLELLTKLASISPSGLEYLDQKGVVTKLNNLLLEVETDPLITLIIPGIIKFF.............................................................................. 278
12 -9.720PF11841.8; W4Z9X2_STRPU/133-288; Domain of unknown function (DUF3361 topsan)  ali follow..  10  20............................................................EEGSQNGEPLSLTLKSFIELMDHNVISWDSLSANYVKKIASFVNRSSDFQVTERALNILESSILNSTKLYNVIANEITFHNMTQHLENVQNPGIQQNCLALMNALCLKAPEDEEALSARNIRVVIMEKI.................................................................................................. 155

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 4 7 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Wooley JC, Godzik A. Probing metagenomics by rapid cluster analysis of very large datasets. PLoS ONE. 2008;3(10):e3375. Epub 2008 Oct 10.