Scheduled maintenance will begin on May 30th, 2025. Server will be temporarily unavailable — learn more.
current user: public

If you have questions about the server, please let us know.

Query: PF08184.11; CU7A_LIMPO/1-59; Cuticle protein 7 isoform family, from PfamA32U

Results of FFAS03 search in PfamA32U
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .
# Score Template Links and tools%idFirst QAVRYANGYTYDIETGQVSSPYTGRVYETKGKAPFYGFGFEHPYHYYPGYYHGYPHAFYLast
1 -43.600PF08184.11; CU7A_LIMPO/1-59; Cuticle protein 7 isoform family  ali  100  1QAVRYANGYTYDIETGQVSSPYTGRVYETKGKAPFYGFGFEHPYHYYPGYYHGYPHAFY 59
2 -7.810PF14785.6; MALF_VIBPA/110-270; Maltose transport system permease protein MalF P2 domain  ali follow..  11  103KFAAVVPLYTLQEDGETLYNNRTQETLRPNMEVGYY....................... 138
3 -6.150PF18621.1; G8RRX0_MYCRN/99-208; Family of unknown function (DUF5628 topsan)  ali follow..  22  2.....PGPLVWDLTNGTAT--DTTESLHNSGWAP......................... 28
4 -5.870PF01353.22; A7S3R2_NEMVE/60-276; Green fluorescent protein  ali follow..  16  15.....VNGHCFEIQGVGEGKAFDGEHVVKGKHLPFLMPSMSYGTKQFAKYPAGMTDFF. 76
5 -5.860PF14431.6; A8L3G2_FRASN/315-455; YwqJ-like deaminase  ali follow..  11  15.....VTSVLLDTRTGRIYEAVNQGKEIPKDLHSILQERLD.................. 50
6 -5.830PF11074.8; D3HLL6_LEGLN/368-516; Domain of unknown function(DUF2779 topsan)  ali follow..  32  1........HFIDFETAMLPIPF-------KGSHPYQGIAFQFSHH.............. 31
7 -5.580PF08066.12; V2XRV5_MONRO/27-118; PMC2NT (NUC016) domain  ali follow..  12  1KATRNSMLLPVDIPYHRSMDSEFSKELDNFSAR.......................... 33
8 -5.420PF18202.1; E0QN07_9ACTO/6386-6539; T-Q ester bond containing domain  ali follow..  13  33VRVTQTGGAKYHV-FSKLVNQANPDQVVSAGMQEFTA...................... 71
9 -5.350PF10934.8; A5I4A4_CLOBH/29-134; Protein of unknown function (DUF2634 topsan)  ali follow..  20  1........YLFDFKTGEFVTNPDGSIARANDLE.......................... 25
10 -5.180PF04630.12; O64291_9CAUD/1-200; Phage tail tube protein  ali follow..  15  59....PGNNTVQDVMIGDIKQKILGFKSDGKGEKPHVAVLINSVYFGFANGIFQES.... 138

FFAS is supported by the NIH grant R01-GM087218-01
1 4 8 0 9 7   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Ye Y, Jaroszewski L, Li W, Godzik A. A segment alignment approach to protein comparison. Bioinformatics. 2003 Apr 12;19(6):742-9.