current user: public

If you have questions about the server, please let us know.

Query: PF08204.11; Q9Q8V0_RFVKA/10-120; CD47 immunoglobulin-like domain, from PfamA32U

Results of FFAS03 search in PfamA32U
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110
# Score Template Links and tools%idFirst AHVGLLLVVFVHLTVGNKVTVMPYTVCNTTITLECNLDELIYKDINSIHVKWLFYTMDDTISNITNGSFIKFDFAKNLSGNYTCEAYSDLNSVKNVIALNLVHQWFSREELLast
1 -63.000PF08204.11; Q9Q8V0_RFVKA/10-120; CD47 immunoglobulin-like domain  ali  100  1AHVGLLLVVFVHLTVGNKVTVMPYTVCNTTITLECNLDELIYKDINSIHVKWLFYTMDDTISNITNGSFIKFDFAKNLSGNYTCEAYSDLNSVKNVIALNLVHQWFSREEL 111
2 -27.200PF17736.1; A0A096NT62_PAPAN/27-121; C17orf99 Ig domain  ali follow..  1............PVVSIAYKVLEVFPKGRRVLITCHAPQASPPI---TYSLCGTKNIEVAKKVVKASFNLNILKSSPDLLTYFCRAATTSGAHVDSARLQMYWE....... 94
3 -26.800PF05566.12; IL18B_VACCW/1-126; Orthopoxvirus interleukin 18 binding protein  ali follow..  11  7..IAFMYGCVHPYVNADEIKCPNLNIVTSSGEFRCTGCVKFMPNFS--YMYWLAKDMRSDEDAK--QKVLHVDTNKFDNYRFTCVLTTIDGVSKKNIWLK........... 126
4 -26.700PF07679.16; Q9GV22_MYTGA/647-736; Immunoglobulin I-set domain  ali follow..  10  3...............FTTQLSPLSLNEGDRLKLTCTVKGQPEPE-----VEWFYNGQLMQSDDAAGHHTLTISCIIDDDGNYVCKAKNPGGQASSRTSVQV.......... 90
5 -25.500PF13927.6; H9IS41_BOMMO/56-136; Immunoglobulin domain  ali follow..  13  1............PPIVRVEPKNITVIEGSKLLLKCEYESNPSSLSA---VFWFRDGERVNVNDTTDQHSLIINARGVDMGNYTCLLTN....................... 81
6 -24.700PF13895.6; F6QPE0_BOVIN/327-404; Immunoglobulin domain  ali follow..  13  5..................ESSATHLDQGEDLNLWCSIPGAPPAN-----FTIQKGSMTV-----SQTQNFTKRVSEWDSGLYTCVAGVGRVFKSNTVQITV.......... 78
7 -24.000PF07686.17; A2BGB5_DANRE/30-142; Immunoglobulin V-set domain  ali follow..  15  1..................TSSELEAVNGTEIRLKCTFKSNRPLSEERTSVSWFKDHVVWSGDVMKGDGSITLDVQFSFNGTYSCQVLNPPDIQGFAGEIKLRV........ 113
8 -23.700PF00047.25; OX2G_MOUSE/143-229; Immunoglobulin domain  ali follow..  10  4....................HLHYNYFEDHLNITCSATARPAPA-----ISWKGTGTGIENSTESTSILRVKDPKTQVGKEVICQVLYLGNVIDYKQSL............ 87
9 -23.100PF02440.15; Q6QPD0_9ADEN/15-113; Adenovirus E3 region protein CR1  ali follow..  14  1...................ALCESVDRDVTITTNYTLKGPPSGM-----LSWYCYFGTDSNYQCNGTDLILLNVTKAYGGSYYCPGQNTEEMIFYKVEVVD.......... 98
10 -22.700PF16706.5; IZUM1_RAT/168-255; Izumo-like Immunoglobulin domain  ali follow..  13  3......................IEVHRLEDMVLDCQLSWHHASEGDYSFYRVWGNSSETLMSKGKEPYLTKTMVGPEDAGNYRCELDTVNAGPATIIYYHVTV........ 85
11 -21.100PF16681.5; F1SAK8_PIG/36-116; Ig-like domain on T-cell surface glycoprotein CD3 epsilon chain  ali follow..  17  2......................KVSISGDKVELTCPEDPESEK------MTWKRNDMQI-YESYDNYMLLESFSEVENSGYYTCTVGEKTSHRENCVEVDL.......... 81
12 -18.600PF09085.10; H0WQ95_OTOGA/112-222; Adhesion molecule, immunoglobulin-like  ali follow..  9....................SPATLVPGVDQEVACTAHKVTPVGSDALSFSLILGDRELEGVQALGTQRWLLPPLGTPILNLYCQATMRLPGLELSRHQAIPI........ 110
13 -17.600PF08205.12; BCAM_BOVIN/150-248; CD80-like C2-set immunoglobulin domain  ali follow..  1............PEVSPNKGILSVMDDFAQEIATCSSRNNPAPQ-----IMWYRNGQPLAVPLESLTSTLYLRLHKPDRESFHCSVHYYLPAGQH................ 99
14 -17.200PF05790.15; Q9GKR2_BOVIN/422-510; Immunoglobulin C2-set domain  ali follow..  10  1..............................VTVSCRVPNVYPSD--QLEIELFKGESIMMNKTFSKSLEKTFIPTTEDIGVLVCLARLPIDEMQSTQTLYVNV........ 89
15 -16.200PF15028.6; A0A2I3G3P5_NOMLE/20-146; Pre-T-cell antigen receptor  ali follow..  4..........GTLFPSLAPPIMLLVDGKQQMVVVCLVLDVAPPGF--DNPIWFSAGNGSALDAFTYLAHLSLPSEELASWELVCHTRPGAEGHSRSTQ............. 102
16 -15.700PF15910.5; A0A287A7M9_PIG/23-135; ICOS V-set domain  ali follow..  10  3.................SAKSEMFMFHDGGLQIVCKYP----DTVRQFKMQLLKGKNILCDLSNNSVSFFLYNLDSSYASYYICELS........................ 90
17 -15.600PF07654.15; H9GZQ9_HORSE/236-322; Immunoglobulin C1-set domain  ali follow..  12  1...............VYVLAPHPDELSKSKVSVTCLVKDFYP---PEINIEWQSNGQPELETKYSTTSKLSVDRNRWQQGTFTCGVMHEA..................... 86
18 -15.100PF03921.14; ICAM2_HUMAN/24-114; Intercellular adhesion molecule (ICAM), N-terminal domain  ali follow..  2...........KVFEVHVRPKKLAVEPKGSLEVNCSTTCNQPEV-----GGLETSLDKILLDEQAQWKHYL-VSNISHDTVLQCHFTCSGKQESMNSNVSV.......... 85
19 -14.700PF06328.11; Q9W6U9_CHICK/29-115; Ig-like C2-type domain  ali follow..  19  7..................IPESPVLALGSNFTALCILNELDFGNIYASQIIWKMKNKVIPKEQNRTVSSVTFNDTSSLASPLTCNVLADGQ.................... 85
20 -13.800PF09191.10; I3NES8_ICTTR/204-310; CD4, extracellular  ali follow..  11  1.................ETLNTVYKKVGEQVELSFPLN---GDEDLRGELKWQAERSSLQVAENLPLRFTLSHALPQYAGSGELTLTLDKGKLQKNVKLVL.......... 107
21 -12.400PF11465.8; CD244_MOUSE/22-129; Natural killer cell receptor 2B4  ali follow..  12  2................PDSSEEVVGVSGKPVQLRP-----SNIQTKDVSVQWKKTEQG-YGFDYGDFALSIKSAKLQDSGHYLLEITNTGGKVCNNFQLLI.......... 106
22 -12.300PF17737.1; H0XJV4_OTOGA/22-112; Ig domain in C19orf38 (HIDE1)  ali follow..  1..................LVPPHPSSQEDPIHISCVA----PRGFLGANFTLYRGEHMVQFLEAPADQNLSGSSSEAPGGPFQCQYGVMGSDFSKPVHVFF.......... 91
23 -11.900PF16407.5; F9ZCN6_ODOSD/19-184; PKD-like family  ali follow..  11  6...GNNDYRFVNTIEVEPFQDSPWAALGDTVRYKPVLHFASGNDELDLAYEWTFAGKTIGDELN-------LEWIVDTVATGQVRVTDRANGLVYSNQKSLRI........ 100
24 -9.810PF16583.5; A9MQ72_SALAR/56-200; Zinc-regulated secreted antivirulence protein C-terminal domain  ali follow..  53..................NIDNAVLSPGESATITTLVKDVDGNPINDVMINVATAHQNGNGLWDIGPVK-----KGVGPGEYTQVIT-YLGNHSETLGVEYS......... 130
25 -9.780PF16820.5; D4IN02_9BACT/104-173; PKD-like domain  ali follow..  16  2...........PVISLALPSQGLKVVRNTDYTFTPDIQH---SDVEGFKIEWVREGKIVSTENT-------YTFNEKELGVYTVTIN........................ 67
26 -9.750PF15096.6; W5P6Q7_SHEEP/18-243; G6B family  ali follow..  12  11...........................GDRVNLSCIGVSQPT-SKGRRPILWASPSGTPTVSPDLGIRRLELLLSAGDSGTFICKGRQ---EEESRTELHVL......... 106
27 -9.630PF06832.12; A6X4J8_OCHA4/603-692; Penicillin-Binding Protein C-terminus Family  ali follow..  11  30...........................DNASPLVLKLQGGRAP------FRWLANGKPIAEIERRRTTNW----QPDGTGYSTLTVVDAAGRAASV............... 88
28 -9.260PF16758.5; UL141_HCMVM/51-241; Herpes-like virus membrane glycoprotein UL141  ali follow..  1..................SPAPVLVAEGEQVTIPCTVMTHSWPMVS-IRARFCRSHDNFSQLHLGQIFSLTFNVSTDTAGMYECVLRNYSHGLIMQRFVIL.......... 110
29 -9.250PF16680.5; W5PHC2_SHEEP/30-100; T-cell surface glycoprotein CD3 delta chain  ali follow..  15  1...........................EDKVILKCNSSI-----------TLLQGTAGQEVSDNK--TLNLGKRIEDPRGMYQCGEKAKSFTLQVYYRM............ 59

FFAS is supported by the NIH grant R01-GM087218-01
1 4 5 9 0 4   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Pawlowski K, Pio F, Chu Z, Reed JC, Godzik A. PAAD - a new protein domain associated with apoptosis, cancer and autoimmune diseases. Trends Biochem Sci. 2001 Feb;26(2):85-7.