current user: public

If you have questions about the server, please let us know.

Query: PF08289.11; M1_I34A1/158-252; Influenza Matrix protein (M1) C-terminal domain, from PfamA32U

Results of FFAS03 search in PfamA32U
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .
# Score Template Links and tools%idFirst QHRSHRQMVTTTNPLIRHENRMVLASTTAKAMEQMAGSSEQAAEAMEVASQARQMVQAMRTIGTHPSSSAGLKNDLLENLQAYQKRMGVQMQRFKLast
1 -83.200PF08289.11; M1_I34A1/158-252; Influenza Matrix protein (M1) C-terminal domain  ali  100  1QHRSHRQMVTTTNPLIRHENRMVLASTTAKAMEQMAGSSEQAAEAMEVASQARQMVQAMRTIGTHPSSSAGLKNDLLENLQAYQKRMGVQMQRFK 95
2 -6.720PF15473.6; H2LFC1_ORYLA/16-167; PEST, proteolytic signal-containing nuclear protein family  ali follow..  20  97.....................................NDSDDSEPEEMPPEAKM---RMKNIGRETPTSAG-KQGFSDHQKLWERKI........ 149
3 -6.630PF08823.11; Q9YC63_AERPE/209-282; Putative peptidoglycan binding domain  ali follow..  12  4.....................................EREDPSDVVKIEDVAGELEKALAALGYYKGPFTGRASKELLQLESWMAINNFENK... 59
4 -6.400PF11109.8; G3SZ93_LOXAF/5-135; Orexigenic neuropeptide Qrfp/P518  ali follow..  22  62.........................ALLVVAKELQTSGKERAGFRFRFGRQDDG--EATRFLPADGEKTSGPLGSLAEELTGYSRKKGGFSFRF. 129
5 -6.400PF08656.10; A5DCD3_PICGU/17-106; DASH complex subunit Dad3  ali follow..  21  11...........................................QYQLLATQLKTLANEVKSINTTASEGPGTADQLLDNFRSLEMKIGLVYTLFR 73
6 -6.250PF11944.8; Y2971_PHOPR/1-125; Protein of unknown function (DUF3461 topsan)  ali follow..  11  61....................................SGSREYKEITEINRTLTHIIDELDIITKRKHTEVDIKKKILGDLRHLERVVSHKISEIE 119
7 -6.130PF01432.20; OPDA_HAEIN/223-679; Peptidase family M3  ali follow..  19  239...THNEVTT-----LFHEFGHGIHHMLTQIVSDVAGINGVPWDAVELPSQFME--EALAFISGHYETGEPLPKEKLTQLLKAKN.......... 320
8 -5.960PF11762.8; ARAA_FLAJ1/362-475; L-arabinose isomerase C-terminal domain  ali follow..  12  42....................RLIVNEVEAVKPMAELPKLPVARVLWDCKPNLEVAATAWILAGGHTVYSQS---ITTEYMEDFADIAGIEL.... 111
9 -5.700PF07746.11; W8WX85_CASDE/29-115; Aromatic-ring-opening dioxygenase LigAB, LigA subunit  ali follow..  22  2...................NRMCFSFNAAECREAFLRDEEAYMTRYNLTEAQKEAVRKMIAAGGHPYYLAKLAGIFGLDMQDIGAQQGVTKEAFQ 83
10 -5.610PF02263.19; GBP1_HUMAN/18-282; Guanylate-binding protein, N-terminal domain  ali follow..  21  9...........................................EALKILSAITQPMVVVAIVGLYRTGKSYLMNKLAGKKKGFSLGSTVQ..... 55

FFAS is supported by the NIH grant R01-GM087218-01
1 3 9 6 1 2   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Ginalski K, Godzik A, Rychlewski L. Novel SARS unique AdoMet-dependent methyltransferase. Cell Cycle. 2006 Oct;5(20):2414-6. Epub 2006 Oct 16.