Scheduled maintenance will begin on May 30th, 2025. Server will be temporarily unavailable — learn more.
current user: public
If you have questions about the server, please let us know.

Query: PF08299.11; D9QS97_ACEAZ/358-426; Bacterial dnaA protein helix-turn-helix, from PfamA32U

Results of FFAS03 search in PfamA32U
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .
# Score Template Links and tools%idFirst IKLIQQIVANHYNLEIEDMKSRKRTRAIAFPRQVAMYLSRELTDSSLPKIGEKFGGRDHTTVLHAYNKILast
1 -57.800PF08299.11; D9QS97_ACEAZ/358-426; Bacterial dnaA protein helix-turn-helix  ali  100  1IKLIQQIVANHYNLEIEDMKSRKRTRAIAFPRQVAMYLSRELTDSSLPKIGEKFGGRDHTTVLHAYNKI 69
2 -5.640PF03505.14; M1ZPH7_CLOBO/230-426; Clostridium enterotoxin  ali follow..  7  42.QYTEERLKDAFNVQLFNTSTSLFKFVEEAPSDKNICIKAYNTYEKYELIDYQNGSIVNKAEYY..... 104
3 -5.140PF16148.5; F0RFZ5_CELLC/37-396; Domain of unknown function (DUF4856 topsan)  ali follow..  17  135............GLEYNQAIAKSIIGGLMVDQMLNNYLSIAVLDEG-NDAGTLVDGKNYTNMEHKWDE. 194
4 -5.100PF18618.1; S3YPR2_9PROT/1-80; HP0268  ali follow..  15  3....LKIARSELSKAPNNISLSDIEKEVAKTGQRIFYFDRENQHKDLIALIEHFKKKNMSAYLRTVK.. 65
5 -5.010PF15152.6; B5M447_PIG/46-121; Kisspeptin  ali follow..  28  44.......................RSRLIPAPRAVLVQREKDLSAYNWNSFGLRYG.............. 76
6 -5.000PF17947.1; A0A0D2E1E2_9EURO/354-430; Four helical bundle domain  ali follow..  11  25.....EAVIEYVAAIAGQLIDEKVVDAPDWVSNTQEYLKTIVGEQDASAIADQLRKK............ 76
7 -4.850PF18482.1; A7TS28_VANPO/183-272; Fungal Pih1 CS domain  ali follow..  9  37...........YNNSSNELFIKNINLHDYNEQELKIPLPNIFNDKDIADMKCFYVKKDRSVYIF..... 89
8 -4.850PF03987.15; B3S1R8_TRIAD/117-184; Autophagocytosis associated protein, active-site domain  ali follow..  8  2......VYSPAYSVPVLYFDPKTTDGRRLALEEIWNTVNLEYAQSVKYDAWSFISQQEHPLLIHPCH.. 68
9 -4.670PF09669.10; Y1412_HAEIN/23-111; Phage regulatory protein Rha (Phage_pRha)  ali follow..  20  5................................................HIATVFG-KRHDNIIRDIKAL 24
10 -4.630PF07056.11; Q8VAE6_WSSVS/117-243; Protein of unknown function (DUF1335 topsan)  ali follow..  9  49LLSMGSILGGESMVPLHDIAHRLSYKGLRIENPIVGSCHDQCLVVPVSMLGKIFSSNMYPTF....... 110
FFAS is supported by the NIH grant R01-GM087218-01
1 4 8 0 6 7   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Pawlowski K, Pio F, Chu Z, Reed JC, Godzik A. PAAD - a new protein domain associated with apoptosis, cancer and autoimmune diseases. Trends Biochem Sci. 2001 Feb;26(2):85-7.