current user: public

If you have questions about the server, please let us know.

Query: PF08464.10; Q0PXT6_9GEMI/196-238; Geminivirus AC4/5 conserved region, from PfamA32U

Results of FFAS03 search in PfamA32U
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40
# Score Template Links and tools%idFirst VLDIMSGLKRLDLTRAFTSPRNIWASVHPVHPGLPVHGPVGPCLast
1 -43.300PF08464.10; Q0PXT6_9GEMI/196-238; Geminivirus AC4/5 conserved region  ali  100  1VLDIMSGLKRLDLTRAFTSPRNIWASVHPVHPGLPVHGPVGPC 43
2 -5.540PF12510.8; G3RYN2_GORGO/655-704; Smoothelin cytoskeleton protein  ali follow..  22  17IEDEGVLDKMLDQSTDFEERKLIRAALRELR............ 47
3 -5.430PF04979.14; H3H518_PHYRM/28-160; Protein phosphatase inhibitor 2 (IPP-2)  ali follow..  14  7.....................TIARHDLDRGTRMKIDEPNTP. 27
4 -4.690PF04837.12; Q9EXK1_PROVU/1-52; MbeB-like, N-term conserved region  ali follow..  18  1....MSRILNLAQTFSESARQDSEIMTEKVKLAIEQH...... 33
5 -4.350PF03985.13; E5S835_TRISP/35-447; Paf1  ali follow..  13  150............INKTFEDA-KKPVREHFSKRDVYA--PLLP. 180
6 -4.270PF13095.6; Q2GMK8_CHAGB/10-214; Kinetochore Sim4 complex subunit FTA2  ali follow..  16  149VRAIVKDLVKGGHPFAAEQISQMWADLKALHELGIMVRDTNV. 190
7 -4.260PF13748.6; G8PNQ8_PSEUV/20-254; ABC transporter transmembrane region  ali follow..  22  11.........RICLTWAGVLAENFLMALIPLLIGFAIDDLL... 41
8 -4.200PF14427.6; A5W3N8_PSEP1/740-859; Pput_2613-like deaminase  ali follow..  28  49...............THTEARITRELSPQAVPGLVIEGEYPPC 78
9 -4.070PF08344.11; E3MD33_CAERE/193-255; Transient receptor ion channel II  ali follow..  21  14..SLQYSLKRINTYRALASPAYM-TSSDPINEAFKLSWDLQKL 55
10 -3.990PF06194.11; Q2FX40_STAA8/3-82; Phage Conserved Open Reading Frame 51  ali follow..  33  10............LNQFFGSKRYLYAHIHVVNGTYYFHGHIVP. 45

FFAS is supported by the NIH grant R01-GM087218-01
1 3 9 8 0 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Pawlowski K, Jaroszewski L, Bierzynski A, Godzik A. Multiple model approach--dealing with alignment ambiguities in protein modeling. Pac Symp Biocomput. 1997;:328-39.