current user: public
If you have questions about the server, please let us know.

Query: PF08793.10; Q0E553_SFAVA/142-176; 2-cysteine adaptor domain, from PfamA32U

Results of FFAS03 search in PfamA32U
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .
# Score Template Links and tools%idFirst YCTNFHRDESRNPLTGKKLVPTSPIRKAWHKMCSGLast
1 -41.800PF08793.10; Q0E553_SFAVA/142-176; 2-cysteine adaptor domain  ali  100  1YCTNFHRDESRNPLTGKKLVPTSPIRKAWHKMCSG 35
2 -5.880PF07173.12; J3N9M9_ORYBR/94-237; Glycine-rich domain-containing protein-like  ali follow..  22  111........TNQENKMKLFRVPTYDVDVMWH..... 132
3 -5.260PF12431.8; Q5WKA0_BACSK/135-171; Transcriptional regulator  ali follow..  29  10....FHHDKTGQPASNVGLRTSGPLPKGIDK.... 36
4 -5.240PF16646.5; G3PCY6_GASAC/4-71; Axin-1 tankyrase binding domain  ali follow..  31  8..GSFREDAPRPPVPGEE................. 23
5 -4.920PF12903.7; Q0S805_RHOJR/7-163; Protein of unknown function (DUF3830 topsan)  ali follow..  22  16........DEDAPLTCDAVWNVLPQSDAYHAKYAR 43
6 -4.690PF10753.9; W0HUR3_9GAMM/7-60; Toxin GhoT_OrtT  ali follow..  35  23.........SRDPSLGIRLLCSALIAVTW...... 42
7 -4.660PF16635.5; H9GCR7_ANOCA/1676-1769; Unstructured region on APC between SAMP and APC_crr  ali follow..  41  16.........NKNQLEVEKKKPTSPVK......... 32
8 -4.610PF05398.11; Q16DV0_ROSDO/1-76; PufQ cytochrome subunit  ali follow..  13  44.........AMHAIKSRSFTDKGPMARAWSQ.... 65
9 -4.340PF07869.12; B8IS35_METNO/3-58; Protein of unknown function (DUF1656 topsan)  ali follow..  16  25.............VLRRLIAWAGLYRFVWHR.... 42
10 -4.170PF14157.6; YMZC_BACSU/29-88; YmzC-like protein  ali follow..  38  37YIKIYEYNESRNEVKLKK................. 54
FFAS is supported by the NIH grant R01-GM087218-01
1 4 4 3 3 6   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Grynberg M, Topczewski J, Godzik A., Paszewski A. The Aspergillus nidulans cysA gene encodes a novel type of serine O-acetyltransferase which is homologous to homoserine O-acetyltransferases. Microbiology. 2000 Oct;146 ( Pt 10):2695-703.