|
current user: public |
|
Query: PF08972.11; A0ZK26_NODSP/6-80; Domain of unknown function (DUF1902 topsan), from PfamA32U |
. 10 . 20 . 30 . 40 . 50 . 60 . 70 . | |||||||
# | Score | Template | Links and tools | %id | First | TIKVQAFWDAEASVWVADASNLPGLVTEAETIEQLTKKLEMMIPELMELNQASSFGKKPVVLDLTSHFQQPIGVG | Last |
1 | -41.900 | PF08972.11; A0ZK26_NODSP/6-80; Domain of unknown function (DUF1902 topsan) | ali | 100 | 1 | TIKVQAFWDAEASVWVADASNLPGLVTEAETIEQLTKKLEMMIPELMELNQASSFGKKPVVLDLTSHFQQPIGVG | 75 |
2 | -24.900 | PF15919.5; E1VAV2_HALED/3-129; HicB_like antitoxin of bacterial toxin-antitoxin system | ali follow.. | 14 | 1 | .YPIAIEIADEQHAYSVVVPDLPGCFSAGDTFDEAVANAREAIEGHLE........................... | 47 |
3 | -22.600 | PF15970.5; B4EVM4_PROMH/3-83; HicB_like antitoxin of bacterial toxin-antitoxin system | ali follow.. | 10 | 1 | NYPATSHFDEESETYEITYRDFDNIHAVAYTEDDIELEASDILHVGLE........................... | 48 |
4 | -13.200 | PF12910.7; A5CZB2_PELTS/1-145; Antitoxin of toxin-antitoxin, RelE / RelB, TA system | ali follow.. | 20 | 59 | TFNPVWEYDEENKLWSVTLPEIR-VYTDAPTKEEAAEQLVDLVLDYCED.......................... | 106 |
5 | -7.830 | PF11524.8; Q6LXP7_METMP/1-80; Selenium binding protein | ali follow.. | 21 | 4 | ..........EGKFIITTADDIPGLSAESDNVDAIVEALKEKV................................ | 44 |
6 | -6.580 | PF17736.1; A0A096NT62_PAPAN/27-121; C17orf99 Ig domain | ali follow.. | 6 | 58 | NLNITLKSSPDLLTYFCRAATTSGAHVDSARLQ.......................................... | 90 |
7 | -6.350 | PF07273.12; D8MQQ0_ERWBE/28-180; Protein of unknown function (DUF1439 topsan) | ali follow.. | 20 | 71 | TMKAQPFFDKEQGAIFLKDMELVDVQVQPEKMQGILKTLTPYLNQSLKD.......................... | 119 |
8 | -6.320 | PF15595.6; L0DJ11_SINAD/268-367; Immunity protein 51 | ali follow.. | 23 | 55 | ....KIDFDPEASLFVAFSPDKEVLRQVATLIRIACQD-EAFLREAIGRAH........................ | 100 |
9 | -6.030 | PF07293.11; E6U2D7_BACCJ/1-75; Protein of unknown function (DUF1450 topsan) | ali follow.. | 25 | 51 | .....................VNGELVSGETNEELLANIYTFIDD.............................. | 74 |
10 | -5.990 | PF07736.11; F6B991_DESCC/5-120; Chorismate mutase type I | ali follow.. | 14 | 4 | .....................IRGATTERNEAQEIFDATQELLRSILEQNQINIEDICSVFFTVTPDLNAAFPAR | 58 |
FFAS is supported by the NIH grant R01-GM087218-01
|
![]() ![]() ![]() ![]() ![]() ![]() |
Selected papers from Godzik Lab Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9. Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018. Plewczynski D, Rychlewski L, Ye Y, Jaroszewski L, Godzik A. Integrated web service for improving alignment quality based on segments comparison. BMC Bioinformatics. 2004 Jul 22;5(1):98. |