current user: public

If you have questions about the server, please let us know.

Query: PF08975.10; B9JYZ4_AGRVS/31-145; Domain of unknown function (DUF1868 topsan), from PfamA32U

Results of FFAS03 search in PfamA32U
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .
# Score Template Links and tools%idFirst RFDAEGNFLPEPGNTIVCHLRAGSESQKAIVALQERYKQMPEADHLAVTPASSLHMTLFQGIIEYRRTAVFWPKDLPLDAPIDDMTEILAQRLTYFAPGPDFRMKIARMLPTGLRLast
1 -73.000PF08975.10; B9JYZ4_AGRVS/31-145; Domain of unknown function (DUF1868 topsan)  ali  100  1RFDAEGNFLPEPGNTIVCHLRAGSESQKAIVALQERYKQMPEADHLAVTPASSLHMTLFQGIIEYRRTAVFWPKDLPLDAPIDDMTEILAQRLTYFAPGPDFRMKIARMLPTGLR 115
2 -10.100PF10469.9; A7UR96_ANOGA/136-349; AKAP7 2`5` RNA ligase-like domain  ali follow..  10  4...............FLSVPLNVLDVMKRFTEFRHKVVRKLPVDESLFQQPEKLHITLCTMALMDNEDRA------NAAQILLDCQESIISPLLQENGPLEIRVRGLEYMN.... 97
3 -9.850PF07823.11; CPD1_YARLI/1-216; Cyclic phosphodiesterase-like protein  ali follow..  10  2............GTSLWLQPPRNSPIWQQLATTIQGLKPI-----FSDSENFEPHITLTSNIS------------VNTQGQVDFVLDRAVAAAKCVPQGFQIHLSSVKYGSRFFK 87
4 -7.500PF05213.12; NS2A_CVMA5/2-253; Coronavirus NS2A protein  ali follow..  18  6...........PNHFINFPLAQFSGFMGKYLKLQSQLVEMGLD----CKLQKAPHVSI......................................................... 48
5 -7.070PF02834.16; Q6NDB5_RHOPA/8-85; LigT like Phosphoesterase  ali follow..  13  1...................LEIPAEISQTLSSLRGGLPGARW------VDPDDYHLTL-------------------IGDIDGVTANEIASTLFRVNR-KPFEVTLQGLSSFGGK 72
6 -6.060PF15068.6; G3TRR0_LOXAF/1-204; FAM101 family  ali follow..  17  136............SQTVTCVPNCTWRNYRAEVRFEPRHRPARFLSTTIVYPKYPKTVYTTTLGYNCRKTLRRFLSSVELEAP.................................. 204
7 -5.930PF18755.1; D6WN26_TRICA/41-160; Restriction Enzyme Adenine Methylase Associated  ali follow..  12  40...........PGNGTMTIEYLGQRFVGDLLE-DGKIRSQETDIVFA--SPSAWAIACKRFINPEKKSGCGWASVKYRGKKLDAYKNIWYRKKKE.................... 120
8 -5.850PF08400.10; FIBER_LAMBD/1-134; Prophage tail fibre N-terminal  ali follow..  17  11..DGTGKPVQ--NCTIQ--LKARRNSTTVVVNTVGSENPDEAGRYSMDVEYGQYSVIL......................................................... 62
9 -5.830PF10794.9; YBFJ_BACSU/1-130; Protein of unknown function (DUF2606 topsan)  ali follow..  10  50..DAKGLPVE--GVQVIVKAPSSDEEPSTEIGEILGKTDKNGDIKWDTGRKGDYSVAL......................................................... 104
10 -5.800PF18236.1; J7RHS4_KAZNA/266-389; Argonaute N domain  ali follow..  16  40.............YELIEALFAED---ETLYKYKDRIAFNGEETLYSHVPLEEF--TLFDGCWDISNKQKNKISVVGLNSGKKTQINELASQV...................... 114

FFAS is supported by the NIH grant R01-GM087218-01
1 4 0 5 9 4   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Reed JC, Doctor K, Rojas A, Zapata JM, Stehlik C, Fiorentino L, Damiano J, Roth W, Matsuzawa S, Newman R, Takayama S, Marusawa H, Xu F, Salvesen G, Godzik A.; RIKEN GER Group; GSL Members. Comparative analysis of apoptosis and inflammation genes of mice and humans. Genome Res. 2003 Jun;13(6B):1376-88.