current user: public

If you have questions about the server, please let us know.

Query: PF09271.11; S2K0N6_MUCC1/331-498; LAG1, DNA binding, from PfamA32U

Results of FFAS03 search in PfamA32U
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .
# Score Template Links and tools%idFirst VIIMTSKVAQKSYGTEKRFLCPPPTAILVGSSWWTPPSLASQQSEEHRQDALFCDKDNVIRAPPSLTICISGETSGQQSGRIEWYALSGTMSNANDDWYRNSRKETLAGGRCVLKRLYINDADEKRKKVECLIKVQLANGLMLGTLSSRGIKVISKPSKKRQSVKNIELast
1 -121.000PF09271.11; S2K0N6_MUCC1/331-498; LAG1, DNA binding  ali  100  1VIIMTSKVAQKSYGTEKRFLCPPPTAILVGSSWWTPPSLASQQSEEHRQDALFCDKDNVIRAPPSLTICISGETSGQQSGRIEWYALSGTMSNANDDWYRNSRKETLAGGRCVLKRLYINDADEKRKKVECLIKVQLANGLMLGTLSSRGIKVISKPSKKRQSVKNIE 168
2 -8.130PF03901.17; F4K887_ARATH/41-451; Alg9-like mannosyltransferase family  ali follow..  32  288VLAIYSILGHK----EFRFVLP-PIALIFSG......................................................................................................................................... 315
3 -7.780PF18156.1; G2GBG6_9ACTN/18-162; pPIWI_RE three-gene island domain Y  ali follow..  19  119LRACRAMSSPESYTAFRRLLVNQPVL.............................................................................................................................................. 144
4 -7.190PF17817.1; A0A0T6BC06_9SCAR/497-568; PDZ domain  ali follow..  33  33................................................................................................................................................TFSVDPIKVYSTFSITEYDRRNED 56
5 -6.450PF10050.9; R5TMS6_9FIRM/20-177; Predicted metal-binding protein (DUF2284 topsan)  ali follow..  36  24..........RSFN--RNWSCPP................................................................................................................................................. 34
6 -6.410PF00554.22; O96458_STRPU/62-250; Rel homology DNA-binding domain  ali follow..  13  1......................................................................................................................................................LKILEQPRQRGFRFR... 15
7 -6.280PF08985.11; B3PEJ4_CELJU/27-168; DP-EP family  ali follow..  12  1................RYFNLKPALATPIGPGDWIFAERGTTTDISSLTVTFPDNQSALERELERAVLVISIEQDEQAGGTWRFALGGVATDQQDEDPNNDIVLDIIDNGFGMLVYIHALQDSYESVPFGFVASFTDATTGVVSIYESQPSVIITRP........... 142
8 -6.030PF11798.8; DPO4_TREDE/168-199; IMS family HHH motif  ali follow..  29  2.............GEEIDFMKSLPLKDVWG.......................................................................................................................................... 18
9 -6.010PF03485.16; SYRC_DROME/81-171; Arginyl tRNA synthetase N terminal domain  ali follow..  16  11......................................................................................................................IASAFPEFRDTPVIIAPVNSTSAKFGDYQCNNAMGLSKKLKEKGINKA.. 58
10 -5.990PF08144.11; E2BXL1_HARSA/453-592; CPL (NUC119) domain  ali follow..  21  20.................................................................................................................................................FPPNVVEYLRQ-SKKPVDVREKE 47

FFAS is supported by the NIH grant R01-GM087218-01
1 3 9 8 0 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Pawlowski K, Jaroszewski L, Bierzynski A, Godzik A. Multiple model approach--dealing with alignment ambiguities in protein modeling. Pac Symp Biocomput. 1997;:328-39.