current user: public

If you have questions about the server, please let us know.

Query: PF09379.10; E41L4_DANRE/15-83; FERM N-terminal domain, from PfamA32U

Results of FFAS03 search in PfamA32U
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .
# Score Template Links and tools%idFirst VLLLDESKLILTTQQQGIKKSTRGSVVLDYVFSHVNLAETEYFGVRYCDRSHQTFWLDPSKTLAEHKDLLast
1 -51.900PF09379.10; E41L4_DANRE/15-83; FERM N-terminal domain  ali  100  1VLLLDESKLILTTQQQGIKKSTRGSVVLDYVFSHVNLAETEYFGVRYCDRSHQTFWLDPSKTLAEHKDL 69
2 -8.260PF18038.1; H2T8R1_TAKRU/36-133; FERM N-terminal domain  ali follow..  15  5VCFSTNNSLGKNFKLVKCDSSWQVRAIIRSILNCGDIKHVGCYGLLLKHKSDELHWLHPDLTVEE.... 74
3 -6.850PF08566.10; A7F581_SCLS1/74-238; Mitochondrial import protein Pam17  ali follow..  10  91..ILGTAAFNLKNRKFRQQMDVKEKEFYARVKKYMANPVPDYYGEKISSVAGYRQWLKDQRAFNRKRQ. 164
4 -6.550PF16190.5; W4XMJ9_STRPU/192-263; Ubiquitin-activating enzyme E1 FCCH domain  ali follow..  16  6VTCLDQQYHGLETGDYVTFKEVKGMTALNDARHKVKRISPYKFSIEDTSGDGFQPYE--TGGIAIEVKV 72
5 -6.030PF00918.17; CCKN_CHICK/3-130; Gastrin/cholecystokinin family  ali follow..  13  75......AKYLQQARKGSTGRFSVLGNRVQSIDPTHRINDRDYMG-----------WMDFGRRSAEEYE. 125
6 -5.810PF15152.6; B5M447_PIG/46-121; Kisspeptin  ali follow..  25  40..........LCTPRSRLIPAPRGAVLVQR--KDLSAYNWNSFGLRY...................... 75
7 -5.630PF15409.6; C5GMH2_AJEDR/217-304; Pleckstrin homology domain  ali follow..  16  20..SLNFTSSTLSYYHDRNSSALRGAIPLNLAVIATNQKTREIWHLRASNDSDFLAWKRALEK....... 87
8 -5.520PF10747.9; R7F1L1_9BACI/2-138; Sporulation inhibitor of replication protein SirA  ali follow..  15  85....KDEVSVLTVKNSYLLITTNQNN--TSFFQILDQYASDFFICDFSNMD----WLSSLK........ 137
9 -5.470PF05351.11; F7C3U3_XENTR/96-252; GMP-PDE, delta subunit  ali follow..  10  57.CFIRLLYCVSTVEFTVGDKPINNFRMIERHYFREQLLKSFDFEFGFCIPSSKNTC............. 111
10 -5.350PF10561.9; H3BF60_LATCH/46-354; Uncharacterised protein family UPF0565 topsan  ali follow..  21  212.....................SKGCVVLNQLLHELKVAKNNKELATFIKNIKAMYWLD........... 248

FFAS is supported by the NIH grant R01-GM087218-01
1 3 8 7 1 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Luz JG, Hassig CA, Pickle C, Godzik A., Meyer BJ, Wilson IA. XOL-1, primary determinant of sexual fate in C. elegans, is a GHMP kinase family member and a structural prototype for a class of developmental regulators. Genes Dev. 2003 Apr 15;17(8):977-90. Epub 2003 Apr 02.