current user: public

If you have questions about the server, please let us know.

Query: PF09759.9; Q5BC22_EMENI/804-903; Spinocerebellar ataxia type 10 protein domain, from PfamA32U

Results of FFAS03 search in PfamA32U
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100
# Score Template Links and tools%idFirst LKKLVVLVLSSLVWKCPEVQDQIRRYGGVETILSCTNFDAHNPYIKEHAVMCLKFLLEGNRENQKLIEELEAREVRDDNGMLQQRGLEAVIDKTGKLAIRLast
1 -65.100PF09759.9; Q5BC22_EMENI/804-903; Spinocerebellar ataxia type 10 protein domain  ali  100  1LKKLVVLVLSSLVWKCPEVQDQIRRYGGVETILSCTNFDAHNPYIKEHAVMCLKFLLEGNRENQKLIEELEAREVRDDNGMLQQRGLEAVIDKTGKLAIR 100
2 -19.800PF17822.1; G3S7I6_GORGO/1-229; Family of unknown function (DUF5584 topsan)  ali follow..  13  117IKILLLQSVACWCYLNPVSQKRAKSLQFIPILISFFEGRFEYLLLKFWTCYVLSVMTCNNLSCVKELKDHSALKYH........................ 201
3 -12.700PF17741.1; A0A151PBS4_ALLMI/1-268; Family of unknown function (DUF5578 topsan)  ali follow..  16  78QLLKAIGIFLSAA-SGHRYLIEFLEVGGVLTLLEILGLSQLKEEDKKESIKLLQLVANAGRKYKELICESYGVRSI........................ 152
4 -11.400PF08045.11; E9DYC2_METAQ/1-287; Cell division control protein 14, SIN component  ali follow..  12  115....ALDLIQGVLLLHPPSKTLFSREQNMNLLLDLLEPF-NCPAIQSATLLTLVVALIDTPSNTRTFEGLDGLLTV--TSLFKSRST------SREVKLK 201
5 -10.700PF11698.8; K5XHD3_AGABU/314-430; V-ATPase subunit H  ali follow..  12  59ILAIAANDVGQYVKHYERGKKFVTDMGGKDRVMELMA--HTNPEVRYRALLSVQQLVSQS........................................ 116
6 -10.400PF04826.13; ARMX3_MOUSE/110-363; Armadillo-like  ali follow..  24  29ILEAALIALGNNA-AYAFNRDIIRDLGGLPIVAKI--LNTRDPIVKEKALIVLNNLSV-NAENQRRLKV............................... 93
7 -10.200PF05804.12; KIFA3_HUMAN/13-720; Kinesin-associated protein (KAP)  ali follow..  10  552LVLEVVIMIGTVS-MDDSCAALLAKSGIIPALIELLNAQQEDDEFVCQIIYVFYQMVFHQATRDVIIKETQAPAYL........................ 626
8 -8.000PF10508.9; A7SP09_NEMVE/2-505; Proteasome non-ATPase 26S subunit  ali follow..  11  181VRMRVYDMYITVQAHSPKAFDVCKESGIFEKLIS--ELDGRDVLVQMNCLELLTKLASISPSGLEYLDQKGVVTKLNN...................... 256
9 -7.900PF03224.14; VATH_ORYSJ/2-323; V-ATPase subunit H  ali follow..  11  226LLYETCLCIWLLSF-YDAAVDYLSTTRVMPRLVEVVK-GSTKEKVVRVVIMSIRNLLAKGAFAAQMIDL............................... 292
10 -7.130PF16782.5; J8Q2G5_SACAR/122-421; Nucleotide exchange factor SIL1  ali follow..  15  71LRELSTRVITSCMRNNPPVVEFIDERGFKGQVILALSNHKFSNILIKRYLSILNELPVTSQDLPIY.................................. 143

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 1 4 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Friedberg I, Nika K, Tautz L, Saito K, Cerignoli F, Friedberg I, Godzik A, Mustelin T. Identification and characterization of DUSP27, a novel dual-specific protein phosphatase. FEBS Lett. 2007 May 29;581(13):2527-33. Epub 2007 Apr 30.