Scheduled maintenance will begin on May 30th, 2025. Server will be temporarily unavailable — learn more.
current user: public
If you have questions about the server, please let us know.

Query: PF09860.9; A5UQH5_ROSS1/112-180; Uncharacterized protein conserved in bacteria (DUF2087 topsan), from PfamA32U

Results of FFAS03 search in PfamA32U
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .
# Score Template Links and tools%idFirst SLKQIPSQPGKLQIILDYVVEAFTPGALYTEKEVNTLMRRFHIDTAALRRYLVDRGMLERKSDGSQYWRLast
1 -50.000PF09860.9; A5UQH5_ROSS1/112-180; Uncharacterized protein conserved in bacteria (DUF2087 topsan)  ali  100  1SLKQIPSQPGKLQIILDYVVEAFTPGALYTEKEVNTLMRRFHIDTAALRRYLVDRGMLERKSDGSQYWR 69
2 -6.600PF15966.5; W5KE54_ASTMX/616-731; F-box  ali follow..  20  5.LSRLPFE------ILQHIARFLDSMSLCQLSLVSQLMREVCGTLLQQRGMVSLKWEKKIYSHGGSCWK 66
3 -6.120PF16932.5; Q877M5_PSESM/48-259; Type IV secretory system, conjugal DNA-protein transfer  ali follow..  14  114....TPENRLQKALWQAAVRQGWGEGRQSADQTLEANFNRLTRDYRGMLMYLLRQGFITA......... 171
4 -5.990PF00329.19; W4YJJ5_STRPU/79-201; Respiratory-chain NADH dehydrogenase, 30 Kd subunit  ali follow..  28  71...................LVPVFKAADWLEREVWDMYGVFFANHPDLRRILTDYGF............ 108
5 -5.990PF05491.13; R7FLP2_9CLOT/266-337; RuvB C-terminal winged helix domain  ali follow..  10  6.........EIDRKYLECLIVRYNGRPVGLNAIASAIGEEATSLEDVYEPFLIKEGLINRTSRGRM... 62
6 -5.950PF12116.8; R6MYF3_9CLOT/3-82; Stage III sporulation protein D  ali follow..  8  16..........ESKATVRKAAKKFGVSKSTVHKDVAERLKYVDPQLYKRVKTVLEINKAQRHIRGGLATK 74
7 -5.710PF14947.6; E6N974_9ARCH/5-85; Winged helix-turn-helix  ali follow..  10  2.........RSKTKIIADILESINQQGHAKPTKILLDANLSYDRLVKYLDMLVEKKLVERVENSETMYV 61
8 -5.580PF13943.6; B9GSN7_POPTR/13-109; WPP domain  ali follow..  15  1SVKLWPPGQSTRLMLVERMTKNFITPSFISRK..................................... 32
9 -5.570PF18576.1; I3E2L1_BACMT/238-300; Helix-turn-helix domain  ali follow..  13  1................SHLLEILREKTYWSFSDIHQELAGYSVDLGVLLEYLIEKNIIE.......... 45
10 -5.490PF14378.6; R7Y200_9ACTN/124-318; PAP2 superfamily  ali follow..  9  129.VAGFASLHVAITLLVALMVQYTLRNRLVHWIFWINFVITVVATLYFGWHYVAD............... 181
FFAS is supported by the NIH grant R01-GM087218-01
1 4 8 0 9 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Plewczynski D, Rychlewski L, Ye Y, Jaroszewski L, Godzik A. Integrated web service for improving alignment quality based on segments comparison. BMC Bioinformatics. 2004 Jul 22;5(1):98.