current user: public

If you have questions about the server, please let us know.

Query: PF09925.9; R6I1F8_9PROT/8-142; Predicted membrane protein (DUF2157 topsan), from PfamA32U

Results of FFAS03 search in PfamA32U
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .
# Score Template Links and tools%idFirst SDWQKRGLITAEQQQKITDYENNVRRPMLYHALLFLSCFCIGIGVIAVIAANWEAIPAAVKLGVDFTLLCTAAWGVWHSRRKGRNLAAEALLTAFALLVLGSIGLVGQIYHLPAHGLSALLFWSVLTFPLLFLSSLast
1 -75.600PF09925.9; R6I1F8_9PROT/8-142; Predicted membrane protein (DUF2157 topsan)  ali  100  1SDWQKRGLITAEQQQKITDYENNVRRPMLYHALLFLSCFCIGIGVIAVIAANWEAIPAAVKLGVDFTLLCTAAWGVWHSRRKGRNLAAEALLTAFALLVLGSIGLVGQIYHLPAHGLSALLFWSVLTFPLLFLSS 135
2 -9.540PF05297.11; LMP1_EBVB9/1-386; Herpesvirus latent membrane protein 1 (LMP1)  ali follow..  16  45SDWTGGALL-----------------------VLYSFALMLIIIILIIFIFRRDLLCPLGALCILLLMITLLLIALWNLHGQALFLGIVLFIFGCLLVLGIWIYLLEMLWRLGATIWQLLAFFLAFFLDLILLI. 155
3 -9.030PF10101.9; B2U841_RALPJ/177-938; Predicted membrane protein (DUF2339 topsan)  ali follow..  13  3..............................NSVVRVGVLFFGVAFLLKYAADNSLLPVEFRLAGVAVGAIVLLGIGWRLREKRP--------GYALVLQGGGVGVL-RVVPLLSPGMAFPLLVLICALAAGLAVK 108
4 -8.840PF10177.9; W5KY66_ASTMX/13-159; Uncharacterised conserved protein (DUF2371 topsan)  ali follow..  27  111................................LKVFGPLVMGIGIFLFICANHENRDKKTKIINL...................................................................... 146
5 -8.520PF04678.13; H2KP42_CLOSI/82-284; Mitochondrial calcium uniporter  ali follow..  11  101..........EELKTMISKEAAKRTRRLTWLGLGAMGLQFGLLARLTWWEYSWDIMEPVTYFVGYGTSMAMYA.............................................................. 163
6 -7.820PF17355.2; D5DXM1_BACMQ/39-160; Family of unknown function (DUF5383 topsan)  ali follow..  14  65AKAKEYNLFSSKNTSYKKERTEQTVSEK-SSDLQWFYLLLIGVGVVILFA..................................................................................... 113
7 -7.700PF04976.12; Q9CK77_PASMU/1-272; DMSO reductase anchor subunit (DmsC)  ali follow..  15  51...............................ALLGIGFIALGFNALNRVGESM--LSNEIATGALFFALAGIYWL-FAILDKLPKAFGRFLLVCASAMGLIFMYMMNKVYHIST-------TWHTSFTTWGFYL. 154
8 -7.520PF16882.5; Q2G177_STAA8/4-226; Domain of unknown function (DUF5079 topsan)  ali follow..  16  8.........................RKPGAQALSLASLFMILFSCLTFFGLDYERFPNYLKITTIIELIIIIISLLQWIAQKYKKIYARFLVIINVLTTITAVFATCNLYYFVANHYDLFNYWLMGTISIIISY. 128
9 -6.890PF06459.12; M3ZZY1_XIPMA/4218-4479; Ryanodine Receptor TM 4-6  ali follow..  10  121....EEAKEPAVEEKPKPRSSQPKEASPAFMSTIFTILDVYLNKILNYLARNFYNL-RFLALFVCFAIILLFYKVTEFVLQESTGYMLPTLRFLAVFHTVISLLCLVGYYCLK--------------VPLVV... 262
10 -6.880PF04247.12; E1VLD4_9GAMM/7-126; Invasion gene expression up-regulator, SirB  ali follow..  13  48...............................SLLTAAILLLFALHWNPFVIPW--------LEAKLSLLLAYIGFGLVTLRFAKTQMGKTLGFVVALFCYVLMFSIARAHD........................ 119

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 2 0 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Veeramalai M, Ye Y, Godzik A. TOPS++FATCAT: fast flexible structural alignment using constraints derived from TOPS+ Strings Model. BMC Bioinformatics. 2008 Aug 31;9(1):35