Scheduled maintenance will begin on May 30th, 2025. Server will be temporarily unavailable — learn more.
current user: public
If you have questions about the server, please let us know.

Query: PF09957.9; B1WYD1_CYAA5/1-47; Bacterial antitoxin of type II TA system, VapB, from PfamA32U

Results of FFAS03 search in PfamA32U
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .
# Score Template Links and tools%idFirst MATNLEIDDQLIQEALKIGGHSTKREVVEAALKEYVQRRKQLEITELLast
1 -29.900PF09957.9; B1WYD1_CYAA5/1-47; Bacterial antitoxin of type II TA system, VapB  ali  100  1MATNLEIDDQLIQEALKIGGHSTKREVVEAALKEYVQRRKQLEITEL 47
2 -6.930PF07362.12; G0A2L0_METMM/9-79; Post-segregation antitoxin CcdA  ali follow..  17  3.ATNITLSADVLAEAKALN---NISQACDLYLRNLVRGEREKR.... 42
3 -6.890PF12879.7; B3L6N4_PLAKH/440-576; SICA C-terminal inner membrane domain  ali follow..  16  65.RTIIEIHFEVLDECQKGDTQLNQKDFLELLIQEFMGSELMES.... 106
4 -6.030PF01402.21; Q8ZX60_PYRAE/47-86; Ribbon-helix-helix protein, copG family  ali follow..  16  2..ISVHVPKKMLDELVRRGIFPNRSEAIRAALRDLLYK......... 40
5 -5.340PF17341.2; L0KVQ8_METHD/1-65; Family of unknown function (DUF5371 topsan)  ali follow..  12  11......LTEEELAALKKKCNEPSTKEALSIAVQHYLE.......... 41
6 -5.250PF17723.1; A9AUR9_HERA2/2-120; Ribbon-Helix-Helix transcriptional regulator family  ali follow..  7  5.KVSMNLSVVDLGQIDLLVDQSSRTDFFRAAIRTRLAGHD....... 46
7 -5.240PF15157.6; H2RDW3_PANTR/4-158; Fusion protein IQCJ-SCHIP1 with IQ-like motif  ali follow..  17  24.QLAMDAENNIEKYPLNLQPLESKVKIIQRAWREYLQRQE....... 62
8 -5.190PF07704.11; A7IPR8_XANP2/1-84; Rv0623-like transcription factor  ali follow..  25  1MSLNIKNPAALADELARRQG-VTKTAAIHQALSERLHRMGYGD.... 44
9 -4.870PF00035.26; DGCR8_HUMAN/512-576; Double-stranded RNA binding motif  ali follow..  14  31FGASVTIDGVTYGSGTASSKKLAKNKAARATLEIL............ 65
10 -4.630PF09386.10; K6Y9R3_9ALTE/1-76; Antitoxin ParD  ali follow..  21  1MRLSIDITPE-LKAAAALQGQSIKNYVLERALPKGNEQEALKKLETF 50
FFAS is supported by the NIH grant R01-GM087218-01
1 4 8 0 6 7   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Friedberg I, Harder T, Kolodny R, Sitbon E, Li Z, Godzik A. Using an alignment of fragment strings for comparing protein structures. Bioinformatics. 2007 Jan 15;23(2):e219-24.