current user: public

If you have questions about the server, please let us know.

Query: PF10084.9; C4KCQ7_THASP/3-101; Uncharacterized protein conserved in bacteria (DUF2322 topsan), from PfamA32U

Results of FFAS03 search in PfamA32U
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .
# Score Template Links and tools%idFirst FADNLKTLPGVSHLAALNLIDAADAVVATIENKPGQAGSLAVYNHLAQLYGAISPEAAKKGLELYAEHTEDARANPGKHPNIDRLIGLIERGETLRVKQLast
1 -67.700PF10084.9; C4KCQ7_THASP/3-101; Uncharacterized protein conserved in bacteria (DUF2322 topsan)  ali  100  1FADNLKTLPGVSHLAALNLIDAADAVVATIENKPGQAGSLAVYNHLAQLYGAISPEAAKKGLELYAEHTEDARANPGKHPNIDRLIGLIERGETLRVKQ 99
2 -9.410PF08888.11; C6X0N0_FLAB3/21-128; HopJ type III effector protein  ali follow..  20  16FQDVIAYIHQHYHFTPTKFTNGN------AVNEAGQNGSCKVFS-----FAKLKGLNEEETLALFGDF-TDVLQNPEDHQNIRNFMQSGWDGIAFE... 104
3 -7.050PF14043.6; Q81YW0_BACAN/3-75; WVELL protein  ali follow..  17  5........................................ALTKELLEKNDKLSYAQARAWVELLWEDFQTTYAKSGRYQGEEMTEQVVRS........ 55
4 -5.890PF11754.8; M2LBQ8_BAUCO/163-423; Velvet factor  ali follow..  15  158.................NLIGSLAVNAAKLYDPQNKTSYWFVLQDLSRTEGHFRLKMSFVNVFVFSEQVFSAKRFPGVIESTDLSKCFSAQGIKIPIRK 259
5 -5.830PF00703.21; A7M4A9_BACO1/231-337; Glycosyl hydrolases family 2  ali follow..  10  11.................DLSNQKALVRMNIRSASSTKGEITLSAASFNTDIQFNIRPGDNPVEMELPMGKEFLTWDEFSPALYKLTAKLTNGKQTDTQQ 101
6 -5.720PF04451.12; MCP_LCDV1/255-455; Large eukaryotic DNA virus major capsid protein  ali follow..  20  92............................VYENSARLNEMGSEYYSLVQPYYFGGSIPIETGYHMYCYSLNMMDMDPMGSTNYGRLSNV........... 151
7 -5.620PF00699.20; URE2_ACIAD/3-100; Urease beta subunit  ali follow..  15  9..............GDIELNVDRPTLKVSVANTGDRPIQVGSHFHFAEANDALQ-RGLTKGYRLNIAAGTAVRFEPGQSRDVELV.............. 80
8 -5.530PF01228.21; A5N4Z6_CLOK5/678-781; Glycine radical  ali follow..  12  11.ADRNGPTSVVKSASKIDQLKTGGALLNQ-PSVVQGEEGISNMATLVRSYFSMDGHHIQFNV-IDRKTLLDAQKHPEEYENL................. 92
9 -5.460PF11964.8; D5ER41_CORAD/12-118; SpoIIAA-like  ali follow..  17  1.......IVGVSATGKVTAQDYERVLIPLIEEKLKRHKKLSCLYQLGPDFEGFEPAALWNDASIGMRHPFSWTR......................... 67
10 -5.290PF13860.6; Q3A5C3_PELCD/99-176; FlgD Ig-like domain  ali follow..  17  16......DLSNNVDEVQLVVQNAKGQTVATLEGTDLSAGEHFIQWNGTDANG----ASLPAGDYQLQISARRD........................... 77

FFAS is supported by the NIH grant R01-GM087218-01
1 4 5 9 0 4   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Friedberg I, Godzik A. Functional differentiation of proteins: implications for structural genomics. Structure. 2007 Apr;15(4):405-15.