current user: public

If you have questions about the server, please let us know.

Query: PF10112.9; U5LFW6_9BACI/8-198; 5-bromo-4-chloroindolyl phosphate hydrolysis protein, from PfamA32U

Results of FFAS03 search in PfamA32U
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190
# Score Template Links and tools%idFirst LIGTVLAVPFAGSVWTVSYFGFDQTFFLSGLIAGGAAALVYLAAFQIGRVRFLRKHGLSRREYKYIKTNLAEGKKKISRLHKSLFAIRHLPSLKQRIELMRITRKIYRLTKKEPKRFYQAERFYFSHLDSLVEMTEKYVFLSTQPKKNLEIDQSLLETRRTINELSQTVEKDLYEVISDDIDNLNFEIDVALast
1 -51.900PF10112.9; U5LFW6_9BACI/8-198; 5-bromo-4-chloroindolyl phosphate hydrolysis protein  ali  100  1LIGTVLAVPFAGSVWTVSYFGFDQTFFLSGLIAGGAAALVYLAAFQIGRVRFLRKHGLSRREYKYIKTNLAEGKKKISRLHKSLFAIRHLPSLKQRIELMRITRKIYRLTKKEPKRFYQAERFYFSHLDSLVEMTEKYVFLSTQPKKNLEIDQSLLETRRTINELSQTVEKDLYEVISDDIDNLNFEIDVA 191
2 -7.630PF04912.14; A0A068YCT6_ECHMU/17-392; Dynamitin  ali follow..  11  250.........................................................LQPSYLEQVEARIATLETRLADVTKNPENVLDADSQNKIAELFEVVKRWNSFSADLPIVIDRLKDLQTLH-AQASEFSTSLVNMEIAQ---KRIDENLATYGSQLRSVQESLSNALSTF-KENTVAIGKAM... 376
3 -7.370PF15676.5; F6YWC8_HORSE/2-552; Six6 opposite strand transcript 1 family  ali follow..  2..................................................................VEDIKENKATICKIHETINTTDESNWKPTCDVFHKHEDYMQDQFTIYQETVEKDKKMYHGYICQYKDVLKQYQLKYSETPFSHEYYEKKREHEEIQNRVLACTEQ---KMNETIFMEFL...... 134
4 -7.360PF10018.9; Q2M0F9_DROPS/39-211; Vitamin-D-receptor interacting Mediator subunit 4  ali follow..  10  1.......................................................................................................GDLLDLLVAKDEEFRKMLELAEEQAKVEDAMDKLRAKVEVHDREIQKLQKSLKDAELILSTAIFQARQKLASINQANKRPVSSEIKYA 90
5 -7.200PF10498.9; IFT57_XENTR/25-383; Intra-flagellar transport protein 57  ali follow..  12  198...................................................ILEVERVLPQLKVTIRTDNKDWRVHVDQMHQHRDGIDTKETKGYLDKLHNEVAKALEKVSSREKYINQLEQLVQEYRSVQAQLSEAKERYQQASGGVTERTRILAEITEELEKVKQEMEEKGSSMLKHEIVQMDIRTGVV 355
6 -7.020PF10168.9; I3KZS6_ORENI/8-718; Nuclear pore component  ali follow..  560.....................................................RRVKLLTGQKNKQLEELSLCREERKSLREAAERLADKDAKYRQETIMNRVKKVLCSLQSQLPILSNSEKEMKKELQTINDQLKHLDNIRQVNMKMEYQKTQVDKDAPQKKVVQDVLKEQGQQIMMKQIKDIKNHFS.. 711
7 -7.010PF15771.5; F7CHR8_HORSE/9-582; Interactor of HORMAD1 protein 1  ali follow..  99...............................................EQFEEKKKRAKDRCDSEALYNFISHTRESIYRLQTSVEKSEE-HLSSRSQSILDSLETVAKTLQET---AQAQSDLVLETAQDKGNMEQAILEMQKRFEARQAEFSEMKSNLKHLEVLVAQQNKDFQQL-CEQLGQLNVPSILA 237
8 -7.000PF05667.11; CCD22_AEDAE/1-553; Protein of unknown function (DUF812 topsan)  ali follow..  13  401...............................................KSQQVLDQIESTRQKCEEVVIDLQTKGAMYARLQKEFEKLNK---TVSRTAYTSRILEIIGNIRKQKNGIDQITRSLQKEINNITGQLDRFTVTDDLIFRNAKKDEHSKRAYKLLVTLHSDCEELIKLVIKREVRDLEDQIE.. 548
9 -6.990PF05983.11; R4X872_TAPDE/8-173; MED7 protein  ali follow..  62........................................................TLQDSGLEQLYPDGYDLVLELKKLSR---------------SLMLNYLELITIMSIAPEQFPGKVEHLRLIMINMHHLINSYRPHQTRESLIVVMEQQIARRTRETEDIELVTSTAREQI............... 166
10 -6.830PF15927.5; G1KTE1_ANOCA/25-225; Cancer susceptibility candidate 1 N-terminus  ali follow..  1......................................................KRLFEEEQARIRAELEEAARREKERIEREKRERLEAKDQERRGVELAELAILEESFLTDPMVRQEINTFMSLWGNRILDLIEKLEMCILDTPFHELSSKDVTQYHDTILQLQALLHHKYNEATEHLLKQASNYAE.. 173

FFAS is supported by the NIH grant R01-GM087218-01
1 4 3 0 4 3   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Zhang Y, Stec B, Godzik A. Between order and disorder in protein structures: analysis of "dual personality" fragments in proteins. Structure. 2007 Sep;15(9):1141-7.