current user: public

If you have questions about the server, please let us know.

Query: PF10583.9; F1MX64_BOVIN/1-68; Involucrin of squamous epithelia N-terminus, from PfamA32U

Results of FFAS03 search in PfamA32U
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .
# Score Template Links and tools%idFirst MSQQHTLPVIQPPALSQESLKPASPPTNTQQEQVKQPTPLPAPCQKVHSELPGEVPLELGEKHTIVKGLast
1 -62.800PF10583.9; F1MX64_BOVIN/1-68; Involucrin of squamous epithelia N-terminus  ali  100  1MSQQHTLPVIQPPALSQESLKPASPPTNTQQEQVKQPTPLPAPCQKVHSELPGEVPLELGEKHTIVKG 68
2 -5.780PF15357.6; PS1C1_HUMAN/4-152; Psoriasis susceptibility 1 candidate 1  ali follow..  27  85..........LVPSSHPELFASVLPMAPEEAARLQQPQPLPPP......................... 117
3 -5.660PF15798.5; H2L8U9_ORYLA/154-284; Proline-rich AKT1 substrate 1  ali follow..  10  63.....SLPVSVPVWGCKSNRAAQGDGNSGERVGCADLEHIAASMKALLVPGATDGTEMFGA....... 118
4 -5.520PF18197.1; G2J3Q6_PSEUL/54-107; Domain of unknown function (DUF5602 topsan)  ali follow..  6.......PISIGLVFTETALQGLPAAAAGGRADFPYQLGMPRKGPRTVVD.................. 48
5 -5.100PF17574.2; ITAS_BPT7/1-89; Inhibitor of toxin/antitoxin system (Gp4.5)  ali follow..  12  42.SKNHTQRMTLTDEQALRLVNALTKAAVTAIHEAGRVNEAMAILDKIDN................... 89
6 -4.840PF17905.1; A0A158PDZ3_ANGCS/162-256; GLD-3 KH domain 5  ali follow..  12  14...QGLLPMQLCFHAGNEDLRAKIEDKNRIVKFYDELLRVSVSVVPSDLESVTVLPGDQTRHYISLRT 78
7 -4.760PF18439.1; A0A0D2AW73_9EURO/3-34; Ubiquitin-Binding Zinc Finger  ali follow..  16  5...........................................CGQCNETIESDRRDEHEDWHFAKK. 28
8 -4.700PF09496.10; C5GN29_AJEDR/145-364; Cenp-O kinetochore centromere component  ali follow..  17  55...RHTIPIFVPTQLEQRYLSVPRGTNGADSAIAKSRKAPKQDLRSLVRELRQELVAWHLRCDAL... 117
9 -4.550PF10365.9; Q7MTE2_PORGI/1410-1571; Domain of unknown function (DUF2436 topsan)  ali follow..  13  78...EYLIPANADPVVTTQNIGEVVIPGGVYDYCITNPEP............................. 118
10 -4.380PF03325.13; VPAP_HCMVM/116-281; Herpesvirus polymerase accessory protein  ali follow..  23  24.SENSAVHVDLDFGVVADLLKWIGPHTRVKRNVKKAPCPTGTVQILVHAGPP................ 74

FFAS is supported by the NIH grant R01-GM087218-01
1 4 5 9 0 4   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Friedberg I, Godzik A. Functional differentiation of proteins: implications for structural genomics. Structure. 2007 Apr;15(4):405-15.