current user: public

If you have questions about the server, please let us know.

Query: PF10633.9; Q67M97_SYMTH/263-339; NPCBM-associated, NEW3 domain of alpha-galactosidase, from PfamA32U

Results of FFAS03 search in PfamA32U
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .
# Score Template Links and tools%idFirst AVAGRKNGVTLEVKNTGTTEITGINFASTLPPNWTATFSPDSIDALAPGESRQVTVEVTPNSKALAGDYLVTLRARSLast
1 -47.700PF10633.9; Q67M97_SYMTH/263-339; NPCBM-associated, NEW3 domain of alpha-galactosidase  ali  100  1AVAGRKNGVTLEVKNTGTTEITGINFASTLPPNWTATFSPDSIDALAPGESRQVTVEVTPNSKALAGDYLVTLRARS 77
2 -19.500PF05753.14; Q9VUZ0_DROME/9-186; Translocon-associated protein beta (TRAPB)  ali follow..  16  31LVEKSDLLVRYTIFNVGSGAATKVRLVDSGFHPEAFDVVGGQVDRIAPQTNFTHVLVVRPKA---FGYFNFTAAEVS 108
3 -18.600PF07705.11; Q8TPY5_METAC/349-453; CARDB  ali follow..  18  19AWNKLNNTVSVTVINNGPENADSFALELYSDG---TPVESRQVTGLANGATETVDFSWKPED---IKDYTLKAVVVP 89
4 -18.600PF03504.13; OMCBD_CHLTR/92-182; Chlamydia cysteine-rich outer membrane protein 6  ali follow..  26  20EYATVGSPYPIEITATGKRDCVDVIITQQLPCEAEFVRSDPKIDRLGQGEKSKITVWVKP................. 91
5 -18.400PF00927.22; EPB42_HUMAN/588-686; Transglutaminase family, C-terminal ig like domain  ali follow..  11AEQYQPLTASVSLQNSLDAPMEDCVISILGR-GLIHRERSYRFRSVWPENTMCAKFQFTPTH---VGLQRLTVEVDC 83
6 -17.900PF01345.18; Q9RWI2_DEIRA/209-325; Domain of unknown function DUF11 topsan  ali follow..  13  10VRAGGETTVNLTLTNNGGDSREAVLLNTPELRDFVFVSGSARTSSVPAGGSLQLSFTLRAPRVTA............ 110
7 -14.700PF14874.6; Q4DUQ4_TRYCC/1589-1690; Flagellar-associated PapD-like  ali follow..  14  16VIRGNRYALPVVFTNTSTVPCR-YRVTLPTECKDILRVHYPR-HFLAPGLTVMAQVEISGTQPLGAMSFSLNVTHEG 90
8 -14.500PF02883.20; Q4DX30_TRYCC/690-800; Adaptin C-terminal domain  ali follow..  18.VVQGAINANIIVFSRLPTAMENLSIQAAVPKTSMLNIGFLTSTVIPPYGRIVQQLIVDNSNSNKNPR......... 84
9 -14.300PF14796.6; K7IWJ5_NASVI/813-956; Clathrin-adaptor complex-3 beta-1 subunit C-terminal  ali follow..  19  83...PALVNIELTFANEGTETIKDIRVGNKNLATGMSLHDFSPIPVLQPNSSLACTIGINFNDSTQ............ 144
10 -13.600PF12690.7; C4L5A1_EXISA/43-141; Intracellular proteinase inhibitor  ali follow..  9.ASAKTLSATISMTNPNEEAVD-VTFNSSQRFQLVVKKGDQTV-KWEANDKKVFDEVF--PLTLEPGEYSVEVIGLG 96
11 -13.600PF06030.12; Q8Y9H6_LISMO/31-150; Bacterial protein of unknown function (DUF916 topsan)  ali follow..  19  22MNPKQKQTLKVEITNHSKEEIT---VNCVANTAVTVKESVSEV-TLKPNETKIWTAAIQMPAENYDGIILGGLHFQE 120
12 -13.300PF03896.16; B0XFI4_CULQU/3-291; Translocon-associated protein (TRAP), alpha subunit  ali follow..  13  91..AGYPVEFLVGFANKGSDDFIVETVEASFPMDFNYFIQNFSAIEIKPGHEATVSYSFLPSESFAGRPFGLNIAL.. 169
13 -12.200PF12371.8; A9UVP6_MONBE/19-102; Transmembrane protein 131-like  ali follow..  13  16...CKVAERVVTVVNGNPR--ADLHLYSISSNSNDFHSSWFEHAVVAPGDNTTFTIAFMS---ETLGPVEANITLLT 84
14 -12.000PF16116.5; R6Y5S7_9BACT/235-498; Domain of unknown function (DUF4832 topsan)  ali follow..  14  157LLAGQANPVEISLINRGFSTLFNLVLIDESGKVCHVALTDANVNDWQPYETGDISTDLQIPLGLAKGMYSLGLWIPD 247
15 -11.900PF07610.11; F0NZP4_WEEVC/51-148; Protein of unknown function (DUF1573 topsan)  ali follow..  11  14.KMNESKDHYFVITNEGKSPL----VIKDARATCGCTVPEWPKEPIPAGGKDSIKVQFTAGTVLGNTQKKVSLTTNT 85
16 -11.800PF04442.14; G4QNV2_GLANF/60-203; Cytochrome c oxidase assembly protein CtaG/Cox11  ali follow..  15  61VHPGEMSEVAFYVRNPTDRDIIAQAIPSVSPGTAALFVNKTE-QPLKAGEEALMPMKFYVDPQLPKDITVFTLQYT. 141
17 -11.600PF16408.5; R6U353_9BACE/1-123; Domain of unknown function (DUF5016 topsan)  ali follow..  11  46AFMGDSVRFSIKLNDEFPLSTLKAKLLFD-------TSVSDLTIRTKTYGTYDAAIFVPLLKDIPDGTAEITFTAQN 116
18 -11.100PF05326.11; G1QRT8_NOMLE/4-126; Seminal vesicle autoantigen (SVA)  ali follow..  43VRPNEEVTATLAVRTELKECMV-VKTYLISSVPLEGGFNYKYTACLCNNNPKTFYWDFYTNR---TVQIAAVVDVIR 115
19 -11.000PF15780.5; G3VKZ4_SARHA/34-131; Abnormal spindle-like microcephaly-assoc`d, ASPM-SPD-2-Hydin  ali follow..  20  22...GVSRTLPLVLDNPNEEGVE-VSVARLPAADKGFSISPQSC-ALQSKERISLSITWTP---AKEGRVREMITFLV 90
20 -10.400PF06159.13; J3KCX7_COCIM/67-339; Protein of unknown function (DUF974 topsan)  ali follow..  15  13...GETFSCSLSANNEASRVVTSIRILAEMQTP-SSDDNDTKSGGIAQVESMQKIVRFDLKE---EGNHVLAVGVS. 96
21 -10.300PF08626.11; C0NZX0_AJECG/5-1447; Transport protein Trs120 or TRAPPC9, TRAPP II complex subunit  ali follow..  16  984...GETRSFDITLQNISTCPLDFISFSFEDSS-WRRDKLHDYELSIAPGETATFTIDIYGKPGLDNAILKIDYANVC 1088
22 -10.300PF11611.8; A4J6Q2_DESRM/57-186; Domain of unknown function (DUF4352 topsan)  ali follow..  15  37...EQFLLVKIKVTNNDKEARTLFKLFDTQGKEYSAMGEADLYEQVNPGMSRSGFIVFEIPKGMQGLTLQCS..... 118
23 -10.300PF06280.12; C5AP_STRP1/597-707; Fn3-like domain  ali follow..  16  7...SDKFEVTVTVHNKSDKPQEQATVQTDKVDGKLFALAPKAL-TIPANSSKQVTIPIDVSQFSK............ 78
24 -10.100PF18368.1; F7W395_SORMK/760-869; Exo-beta-D-glucosaminidase Ig-fold domain  ali follow..  13  34PKGHSESAMQVTLENHSSVPAFFIRLNLVDKDGKDVLPVDDNYLTLWPREKITVKVRPFGGAAEPA........... 101
25 -9.700PF17766.1; W9RTY5_9ROSA/687-795; Fibronectin type-III domain  ali follow..  13  18.....EISVPRTVTHISDGAAI-YTVKITNPKGTVVFVSPEKMAFDKKGDRGSYVVTIFADNSSSTF.......... 78
26 -9.650PF09478.10; Q54LG4_DICDI/193-274; Carbohydrate binding domain CBM49  ali follow..  21  20.......QYKLTLTNNEATAIKSIEIHSDPTEFWNIERNVQT-STLKVGESFSFGFVSS.................. 82
27 -9.540PF09624.10; Q0PBN9_CAMJE/20-169; Protein of unknown function (DUF2393 topsan)  ali follow..  15  59....ESVIVSGKVQNLTKFEIKKCYLILSILNQ-SVSYTIEIIDTLPGNTYKEFRASVPFPPTFNNPEFYHTLKC.. 149
28 -9.330PF02102.15; PLNC_PENCI/1-351; Deuterolysin metalloprotease (M35) family  ali follow..  17  33LSQVSDTRIKAVVKNTGAENVTFVHLNFFRDENNEVVFASESLTTLEAGEVLEDEFDIATTTDLSSGAITLRSNGL. 132
29 -9.320PF11614.8; Q2YM86_BRUA2/388-513; IG-like fold at C-terminal of FixG, putative oxidoreductase  ali follow..  20  34.......GYTVKLLNMIPTP-RTFQLSIQGLPEATLTVQDETPDAVEPDKLKNLRVFVTMPHDVTEPRKDYEIEVRA 110
30 -9.200PF00868.20; F6YIG4_XENTR/4-124; Transglutaminase family  ali follow..  19  33...GQPFKLTLMLNRPLQAEENILFIRAENLQSWGA--------ILTSIKSTSITVTINSHSDAVIGRYILSVAVQ. 121
31 -9.060PF11797.8; K8E1D6_CARML/133-270; Protein of unknown function C-terminal (DUF3324 topsan)  ali follow..  18  44.......AVTVNLQNTEATIIKEFDVHAKV-NGTVLHEATKTEMSMAPNSNFDFPISWD-NQSLEPGTYTLDMTAKS 115
32 -9.060PF14646.6; H0WS01_OTOGA/246-665; MYCBP-associated protein family  ali follow..  25  240TVEGEKTSSDLTVVNNGTVAIW----------DWRRRDLPDTFHDILPGETKNFTFFFKSLT---AGIFR....... 314

FFAS is supported by the NIH grant R01-GM087218-01
1 3 9 8 0 4   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Pawlowski K, Jaroszewski L, Bierzynski A, Godzik A. Multiple model approach--dealing with alignment ambiguities in protein modeling. Pac Symp Biocomput. 1997;:328-39.