Scheduled maintenance will begin on May 30th, 2025. Server will be temporarily unavailable — learn more.
current user: public
If you have questions about the server, please let us know.

Query: PF10683.9; Q8T636_MAMBR/127-194; Hermes transposase DNA-binding domain, from PfamA32U

Results of FFAS03 search in PfamA32U
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .
# Score Template Links and tools%idFirst RPSELIIVSENDKKVAIEKCTQWVVRDCPPFSAVTGAGFKKKVKFFLQIGAIYGEQVDVDDLLPDPPTLast
1 -47.400PF10683.9; Q8T636_MAMBR/127-194; Hermes transposase DNA-binding domain  ali  100  1RPSELIIVSENDKKVAIEKCTQWVVRDCPPFSAVTGAGFKKKVKFFLQIGAIYGEQVDVDDLLPDPPT 68
2 -7.380PF12279.8; G0AJF7_COLFT/5-131; Protein of unknown function (DUF3619 topsan)  ali follow..  14  92........QQHRINDTADIDAAVLSDEL-PPSAYLDNGFSAYLA........................ 126
3 -7.090PF10380.9; A7TM59_VANPO/698-808; Transcription factor CRF1  ali follow..  13  21.STKAKEVVGANVVGLRPPKLGTWETNSKPFSIIDGLSTKSLYP........................ 63
4 -6.340PF10752.9; D3FXJ5_BACPE/1-83; Protein of unknown function (DUF2533 topsan)  ali follow..  9  19..KEFLALDEKREAAIDRVVE--DAKKGLHISLNEVNAITKEMNQIAQDFYFPPRKEVTTDMVRE... 79
5 -5.970PF12315.8; B9HT51_POPTR/266-476; Protein DA1  ali follow..  17  154SSSSKKGEKSQVEKKLGDFFMHQIAHDATP---AYGEGFRSANAAVSKYG.................. 200
6 -5.720PF13466.6; A1W422_ACISJ/2-83; STAS domain  ali follow..  9  10..RHAGATLRMLLQGLKAQDESLVVVDAGALTAFDSSALAVLLE........................ 51
7 -5.340PF13611.6; C7C6C1_9POTY/195-312; Serine peptidase of plant viral polyprotein, P1  ali follow..  6  21VKTKHEPKIVANISDLTKTLTQICCESGIPIIDLDHRKRRAIPMV....................... 65
8 -4.980PF03105.19; Q6BRW8_DEBHA/1-386; SPX domain  ali follow..  11  332.........AYARKQLEDAIIVH----LKSFRELNRTAFRKLTKKFDLAMHTSISAPYMEKI...... 386
9 -4.890PF09218.10; F6D2P2_METPW/55-169; Domain of unknown function (DUF1959 topsan)  ali follow..  15  77.......LTEDETENITNKIVNEVLKENKSYDEAIKDGRKDLLEFL...................... 115
10 -4.830PF10440.9; K3ZX78_SETIT/9-70; Ubiquitin-binding WIYLD domain  ali follow..  4  12DHFAPMGYTARQVRTAVNALLKEYLGA-AAWPFLEDSSYLVVQEKLLE.................... 58
FFAS is supported by the NIH grant R01-GM087218-01
1 4 8 0 9 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Plewczynski D, Rychlewski L, Ye Y, Jaroszewski L, Godzik A. Integrated web service for improving alignment quality based on segments comparison. BMC Bioinformatics. 2004 Jul 22;5(1):98.