current user: public

If you have questions about the server, please let us know.

Query: PF10747.9; R7F1L1_9BACI/2-138; Sporulation inhibitor of replication protein SirA, from PfamA32U

Results of FFAS03 search in PfamA32U
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .
# Score Template Links and tools%idFirst RIYYAFSMKEEIKKLYEDHPLNLYLILRNLYFMREADQEYAVYLYKQMINKLNKSKIDRDLFIQYHNTYTYSKNGEKHIINNLYKDEVSVLTVKNSYLLITTNQNNTSFFQILDQYASDFFICDFSNMDYFWLSSLKLast
1 -76.200PF10747.9; R7F1L1_9BACI/2-138; Sporulation inhibitor of replication protein SirA  ali  100  1RIYYAFSMKEEIKKLYEDHPLNLYLILRNLYFMREADQEYAVYLYKQMINKLNKSKIDRDLFIQYHNTYTYSKNGEKHIINNLYKDEVSVLTVKNSYLLITTNQNNTSFFQILDQYASDFFICDFSNMDYFWLSSLK 137
2 -6.370PF15406.6; H6BUU9_EXODN/90-198; Pleckstrin homology domain  ali follow..  6.........................................KHYFWLSDEPLTSESLASFLRSEKPEGKHSTAAKGLLFFAKRVEDKASPVGIINLADASNVIKDGYDQFSFKAGGHQHRFEASKPTERDGWVVAIE 107
3 -6.300PF09981.9; Q3IXP0_RHOS4/4-92; Uncharacterized protein conserved in bacteria (DUF2218 topsan)  ali follow..  11  8....................................................NASKYLQQLCKHFAHKVEVRFDETEGHCAL--PPGPAVLRADADGLTVQVEAEDAKGLIQARFVIDS-FAFREGFTGLDW..... 88
4 -6.070PF15405.6; G1XBW2_ARTOA/827-954; Pleckstrin homology domain  ali follow..  23.........................LFDHAILLVKIKVVNKRDQYKVYKRPIPLELLVINEMAEVLPERGIKRPPSSLLPKAGNQQKADANAKNGYSITFQHLG---------KRGYVLSLFAATVVGRRKWMEHIE 125
5 -5.890PF05762.14; Q98NL4_RHILO/172-392; VWA domain containing CoxE-like protein  ali follow..  56VHPPLVVL--DISGSMSQYTRIFLHFLHALTEKRRRVHTFVGTRLTNLTRQMRHRDPDAALADCSAAVKDWSGGTRIGDTLAEFNLAWSRRVLGQGAVVLLITDDVAGLSQEMERLHKSC-------RRLIWLNPLL 190
6 -5.860PF11644.8; R6YAI6_9BACE/21-217; Protein of unknown function (DUF3256 topsan)  ali follow..  10  3......................................SLQAQNMKELFVAMPDTLVPLLTKVNREDFGDFLASKMKAEVRNRFGKTSEMTELTDDYLYLKMTSVSSMEMKLLPLKDSLKVIC.............. 87
7 -5.580PF14926.6; CK070_XENTR/15-260; Domain of unknown function (DUF4498 topsan)  ali follow..  11  124.....FTISDELRKVLLLDDCEKHDVFSQ-----SDREQFLFLLFKHLCLGGAICQFEDTIGPYLETTKSIYKD----LLSVQKDPETKQIRIISTVFKVSAYDENGMCYPSGRPHQQTFA--------YLIVDPLK 238
8 -5.560PF13457.6; Q03CH3_LACP3/581-659; GW (Gly-Tryp) dipeptide domain  ali follow..  12  43......................................................................................................NGKAVHVTAQATNKWSTYVQVTTADGTRFWID... 74
9 -5.520PF09379.10; E41L4_DANRE/15-83; FERM N-terminal domain  ali follow..  15  5....................................................................................DESKLILTTQQQGIKKSTRGSVDYVFSHVNLAETEYFGVRYCDRS--WLDPSK 61
10 -5.520PF15413.6; A0A0D2UEA3_CAPO3/130-226; Pleckstrin homology domain  ali follow..  17  61......................................................................................................KHSDSGHFSINTEARRYILAARDKETMLGWLGSLQ 95

FFAS is supported by the NIH grant R01-GM087218-01
1 3 9 2 2 3   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Slabinski L, Jaroszewski L, Rodrigues AP, Rychlewski L, Wilson IA, Lesley SA, Godzik A. The challenge of protein structure determination--lessons from structuralgenomics. Protein Sci. 2007 Nov;16(11):2472-82.