current user: public
If you have questions about the server, please let us know.

Query: PF10929.8; K9VX85_9CYAN/6-70; Protein of unknown function (DUF2811 topsan), from PfamA32U

Results of FFAS03 search in PfamA32U
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .
# Score Template Links and tools%idFirst SILAEIPEELHESLKGYLDTHPNWDQDRVFAAALSLFLLQNGNGKTTEVSQNYRACARVYLETLFLast
1 -51.700PF10929.8; K9VX85_9CYAN/6-70; Protein of unknown function (DUF2811 topsan)  ali  100  1SILAEIPEELHESLKGYLDTHPNWDQDRVFAAALSLFLLQNGNGKTTEVSQNYRACARVYLETLF 65
2 -6.350PF13984.6; D4GC06_PANAM/3-124; MsyB protein  ali follow..  21  1.MFTTLEEAIDAAREEFLASHPDIEQDAINQFGLQKYVMQDG....................... 43
3 -5.530PF18377.1; G1KHZ7_ANOCA/140-270; FERM F2 acyl-CoA binding protein-like domain  ali follow..  16  70SFKECIPRSFCRQIQQ------NYLTKFRIRNVFRRFLQRFQRHTMSTGKLTEQDIMHKYLATL. 128
4 -5.520PF10038.9; B4RAC5_PHEZH/1-69; Protein of unknown function (DUF2274 topsan)  ali follow..  19  16KLTVELPGAVHRDLVAYGEALAA-EPAKLIVPMLSRFMNTD........................ 61
5 -5.190PF12651.7; A5N8S1_CLOK5/8-51; Ribbon-helix-helix domain  ali follow..  14  4RIYNAVDTILYTKLMQ-LSKEIMIPISKLLDKAVELVPREYA....................... 44
6 -5.180PF15213.6; F6SM24_HORSE/12-148; CMT1A duplicated region transcript 4 protein  ali follow..  19  2TENIGLPLNL-------LEKHNPWPAYVTYASPVVKKLIEKSKARELECMQALEESRR....... 52
7 -5.140PF00737.20; D0VMY5_VOLCA/25-76; Photosystem II 10 kDa phosphoprotein  ali follow..  13  1..QTPLGTLLRPLNSEAGKVLPGWGTTVLMGVFIVLFAA.......................... 37
8 -5.140PF00674.18; E7Q3W1_YEASB/73-171; DUP family  ali follow..  12  33.......DFKINLLVEVIKRKPEWRT---ITYNMNQYLFDHRLWNTPYCFYDDEDCHHYFLRLIE 92
9 -5.050PF01402.21; Q8ZX60_PYRAE/47-86; Ribbon-helix-helix protein, copG family  ali follow..  20  2.ISVHVPKKMLEELDELVRRGIFPNRSEAIRAALRDLLYK......................... 40
10 -5.040PF09274.10; Q9F809_ERWAM/1-76; ParG  ali follow..  15  36RVNVNFNEEKHTRFKAACVKN-GTSITDVINQLVDNWLTEH........................ 75
FFAS is supported by the NIH grant R01-GM087218-01
1 4 7 8 6 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Rychlewski L, Jaroszewski L, Li W, Godzik A. Comparison of sequence profiles. Strategies for structural predictions using sequence information. Protein Sci. 2000 Feb;9(2):232-41.