current user: public

If you have questions about the server, please let us know.

Query: PF11047.8; SOPD2_SALTY/1-319; Salmonella outer protein D, from PfamA32U

Results of FFAS03 search in PfamA32U
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .
# Score Template Links and tools%idFirst MPVTLSFGNRHNYEINHSRLARLMSPDKEEALYMGVWDRFKDCFRTHKKQEVLEVLYTLIHGCERENQAELNVDITGMEKIHAFTQLKEYANPSQQDRFVMRFDMNQTQVLFEIDGKVIDKCNLHRLLNVSENCIFKVMEEDEEELFLKICIKYGEKISRYPELLEGFANKLKDAVNEDDDVKDEVYKLMRSGEDRKMECVEWNGTLTEEEKNKLRCLQMGSFNITTQFFKIGYWELEGEVLFDMVHPTLSYLLQAYKPSLSSDLIETNTMLFSDVLNKDYDDYQNNKREIDAILRRIYRSHNNTLFISEKSSCRNMLILast
1 -109.000PF11047.8; SOPD2_SALTY/1-319; Salmonella outer protein D  ali  100  1MPVTLSFGNRHNYEINHSRLARLMSPDKEEALYMGVWDRFKDCFRTHKKQEVLEVLYTLIHGCERENQAELNVDITGMEKIHAFTQLKEYANPSQQDRFVMRFDMNQTQVLFEIDGKVIDKCNLHRLLNVSENCIFKVMEEDEEELFLKICIKYGEKISRYPELLEGFANKLKDAVNEDDDVKDEVYKLMRSGEDRKMECVEWNGTLTEEEKNKLRCLQMGSFNITTQFFKIGYWELEGEVLFDMVHPTLSYLLQAYKPSLSSDLIETNTMLFSDVLNKDYDDYQNNKREIDAILRRIYRSHNNTLFISEKSSCRNMLI 319
2 -37.700PF06767.11; Q8VTL2_SALCE/1-337; Sif protein  ali follow..  16  1MPITIG-NGYLKSEIFITPP-----GNTREAWWKVLWEKIKDFFFSTGKAKADSCLHEMLFADSPPSRE---------RLTEIFFELKALACASHKDRFQVYNPENDATIIFRIMDE-------------NEEVELLRITQSTDTFSYKIMGRSYFLIEDYPGILKSHPQMRLVINKRYSEVVDYPLPSTLCLKLAGAPMLSV--PLDNIDGYLYSEWRKGNLDEWKAQEKATY-------LEAKIQSGIKKTIQTLRHANISE------STQQSALLKTMTMCGLKPVETPPPHTHIPIEKMVEEVLLADKKFQACL. 276
3 -7.480PF14580.6; H3BFR2_LATCH/1-175; Leucine-rich repeat  ali follow..  15..............................................................................................................................................................................................................................YTNPVRDRELDLRGYKIPVIENLGATLDQFDTIDFSDNEIRKLDGFPLLKRLKTLLMNNNRICRIGEGL-PNLRELILTSNSIQELGD......... 105
4 -6.430PF04033.12; O30319_ARCFU/41-138; Domain of unknown function (DUF365 topsan)  ali follow..  15  1MKFVFYQSHEDTGFVGEARIKRVVLSENPM----QFFETFGDRVFLTKDE-----LKEYMKSQERWGRRRESKKKKLWMAIE-LEDVKKYDKPIKPKRL............................................................................................................................................................................................................................ 89
5 -6.330PF11695.8; Q9A5F4_CAUVC/31-168; Domain of unknown function (DUF3291 topsan)  ali follow..  64.................................LSVWPSLGAFVYRSGHVEIMRRRREWFEHMDLYMALWWVPAGHTPTVEEALEKLAHLEAHG-PAAFTFK......................................................................................................................................................................................................................... 136
6 -6.050PF14223.6; M7ZB77_TRIUA/364-501; gag-polypeptide of LTR copia-type  ali follow..  10  15.............FLSDQVIYHVMDENSPK----KIWEKLESQFMSKTAMTKVYLLHGMRIQEGSDLVEYMNAFNQVVTDLARLGALCSL--PSSYDHLITTLTHGKETIKNE.............................................................................................................................................................................................................. 122
7 -5.950PF18532.1; A0A0W0WHF5_9GAMM/255-392; Domain of unknown function (DUF5621 topsan)  ali follow..  12YHEERDAYLKSGMKTNLTDGIPVPRVQRSLNNHLDFYVKNADFFINQLERELFKITFNYLFEQNQFDIRFPEDSHVTQEQVQY--ELNSLKQR.................................................................................................................................................................................................................................. 106
8 -5.840PF02984.19; Q4DWL9_TRYCC/229-371; Cyclin, C-terminal domain  ali follow..  55KSSQQANASLF---LALVTLRIKQKGGSCSFAGETIWTRQLQHYSRAKVHDFKACAEAILEFVNYVPTTKYQAVRRKYSS-AKYGEVAKLIMP.................................................................................................................................................................................................................................. 143
9 -5.830PF11719.8; A7ERI1_SCLS1/13-528; DNA replication and checkpoint protein  ali follow..  1................SKTLRVELKV----------WEK----FQNN-------------NQGRKAAREDIKANPDIASKYKEFNKVRDILAGK................................................................................................................................................................................................................................. 52
10 -5.710PF07741.13; M2QT23_CERS8/458-559; Brf1-like TBP-binding domain  ali follow..  10  3..............LDEEELDQFLLTEEEVRIKERVWVEMLDYLEAIAAKSEQQAEAE-GSTAAESVRNLIKKNPKYSKRIN-YDALKDL..................................................................................................................................................................................................................................... 100

FFAS is supported by the NIH grant R01-GM087218-01
1 4 5 9 0 4   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Friedberg I, Godzik A. Functional differentiation of proteins: implications for structural genomics. Structure. 2007 Apr;15(4):405-15.