current user: public

If you have questions about the server, please let us know.

Query: PF11109.8; G3SZ93_LOXAF/5-135; Orexigenic neuropeptide Qrfp/P518, from PfamA32U

Results of FFAS03 search in PfamA32U
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130
# Score Template Links and tools%idFirst YPLSYLLLLPLGVCFPLADREESGDTLGGIRAKTSWAHLAQWHRPNFRWGSSWQPRAPQPLALLVVAKELQTSGKERAGFRFRFGRQDDGDEATRFLPADGEKTSGPLGSLAEELTGYSRKKGGFSFRFGRLast
1 -89.000PF11109.8; G3SZ93_LOXAF/5-135; Orexigenic neuropeptide Qrfp/P518  ali  100  1YPLSYLLLLPLGVCFPLADREESGDTLGGIRAKTSWAHLAQWHRPNFRWGSSWQPRAPQPLALLVVAKELQTSGKERAGFRFRFGRQDDGDEATRFLPADGEKTSGPLGSLAEELTGYSRKKGGFSFRFGR 131
2 -7.430PF00679.24; EFG_SALTY/611-696; Elongation factor G C-terminus  ali follow..  12  4..........................................................EPIMKVEVETPEENTGDVIGDLSRRRGMLKGQESEVTGVKIHAEVPLSEMFGYATQLRSLTKGRASYTMEFLK 76
3 -6.950PF18664.1; A0A083ZVM1_9GAMM/167-283; CdiA C-terminal tRNase domain  ali follow..  12  1..................................................................LAEGSAASELQNSMGGNLERVDPDISGADFIFTSGPNKGKTVDFMFTTAKGTAKEIEGMNKFFNN 65
4 -6.530PF13389.6; A2EC02_TRIVA/8-170; Protein of unknown function (DUF4107 topsan)  ali follow..  12  20.................................................................ITNTLRKNTGMMVGAAVKHLKSEKLKKLGNFAADQSSNLLGDSNPITKNLHDFSGQLNGEKFNLNP 85
5 -6.460PF16202.5; G5B1S9_HETGA/1-365; N-terminal region of Bloom syndrome protein  ali follow..  40  2.......................................................................................................AAIPLNNLQEQLERHSAKPCGFTFK... 38
6 -6.400PF08289.11; M1_I34A1/158-252; Influenza Matrix protein (M1) C-terminal domain  ali follow..  22  26.............................................................STTAKAMEQMAGSSEQAAEAMEVASQARQ-QAMRTIGTHPSSSAGLKNDLLENLQAYQKRMGVQMQRF.. 94
7 -6.210PF17579.2; Q04306_LACKL/1-159; Family of unknown function (DUF5482 topsan)  ali follow..  13  14.................................................GKAKKFTEEEEKWITPIYYEGESLDFTLKNKYVKINKIEENSYGKKFVTIKSKEYSKIIESISEKLGTVSPISSDGSFR... 92
8 -6.020PF12486.8; Q7MZS6_PHOLL/309-454; Type VI secretion system, EvfB, or VasL  ali follow..  15  21............................................................SQLLQQLRTLWPASQAVQDMQNQWLHQREAAALPMQSLENYHLAQLRLQHLTERLDALDEKRGRY...... 85
9 -6.020PF00257.19; M4EQW9_BRARP/22-179; Dehydrin  ali follow..  11  105.................................................................IKEKLSGGKHKDEQTPSTATTTGPTTTTGAAAADQHHEKKGILEKIKEKLPGHH............ 158
10 -5.730PF15003.6; D7LFN8_ARALL/19-209; HAUS augmin-like complex subunit 2  ali follow..  14  32......................................................SNGEKGDDLIRVLRELSAVQRKIADLQVELQGRKDDKNVAHLTHVS-QKKIETLSRITQILKDVIQNKDRIIARLQQ 109

FFAS is supported by the NIH grant R01-GM087218-01
1 3 9 2 2 3   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Slabinski L, Jaroszewski L, Rodrigues AP, Rychlewski L, Wilson IA, Lesley SA, Godzik A. The challenge of protein structure determination--lessons from structuralgenomics. Protein Sci. 2007 Nov;16(11):2472-82.