current user: public

If you have questions about the server, please let us know.

Query: PF11144.8; Q0P8U7_CAMJE/5-402; Protein of unknown function (DUF2920 topsan), from PfamA32U

Results of FFAS03 search in PfamA32U
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .
# Score Template Links and tools%idFirst QTFEIDSCDDVELGIKRTSKLEYRISYDDEKDIKAIVFIVGGFGANANISFLDFDREYIAKNFDVVVVHVFYHCFCARQSIDQKYNPKLIPNQDDLERVNGILKNINLGHLSVNKDNFEQIIPLIEQKVNKMKQAGLVDESQKIELSCDFIPPNGDYQNYGIMAAIDHINALKDLVKRFPKFADLPKIYGGGSYGGYLSLLIAKIAPWYVDGVIDNSGVCLPFLACILGREMNQGEFYFEGSGYRLYCFVYKYWNRNMNSSYYFGDENYLIRAVLNSNHLQIQSNLNKNTIFVSYHSIQDMGAPVQNKIELYKCYQELGYDATLHLIKDENDIDGRFVKSLEHGLRMTDRALFRKELPLMLEKLQGRKSFMQENSISYPCGNKVFVFKDLEDKFELEMLast
1 -128.000PF11144.8; Q0P8U7_CAMJE/5-402; Protein of unknown function (DUF2920 topsan)  ali  100  1QTFEIDSCDDVELGIKRTSKLEYRISYDDEKDIKAIVFIVGGFGANANISFLDFDREYIAKNFDVVVVHVFYHCFCARQSIDQKYNPKLIPNQDDLERVNGILKNINLGHLSVNKDNFEQIIPLIEQKVNKMKQAGLVDESQKIELSCDFIPPNGDYQNYGIMAAIDHINALKDLVKRFPKFADLPKIYGGGSYGGYLSLLIAKIAPWYVDGVIDNSGVCLPFLACILGREMNQGEFYFEGSGYRLYCFVYKYWNRNMNSSYYFGDENYLIRAVLNSNHLQIQSNLNKNTIFVSYHSIQDMGAPVQNKIELYKCYQELGYDATLHLIKDENDIDGRFVKSLEHGLRMTDRALFRKELPLMLEKLQGRKSFMQENSISYPCGNKVFVFKDLEDKFELEM 398
2 -34.500PF00326.21; Q55413_SYNY3/423-633; Prolyl oligopeptidase family  ali follow..  12  8...............................................................................................................................QYWTSRGFAYVDVNYGGSTGYGRDYRQRLNGQWGIVDVADCVNAARYLADQG-LVDGEQLAISGGSAGGYTT-LAALTFHNVFKAGASYYGVSDLTALATDTHKFEARYLDGLIGPYPE-------------------------RKDLYERRSPVNHADQLTCPVIFFQGLEDKVVPPNQTEMMVQALKAKGIKVEYVAFPEE----QHGFRMAANIKKASELAFYGEVF......................................... 208
3 -24.200PF05448.12; Q8DNU1_STRR6/1-317; Acetyl xylan esterase (AXE1)  ali follow..  10  56.........ELTFEGSKEGKVYARIVLPKSEEKVPLIFHFHGYMGRGWDWA--------------------------------------------------------------------------DMLGFTVAGYGVVSMDVRGQSGYSQDGLRSPLGNFYKDVYLDIYQLVEIVASL-SQVDEKRLSSYGASQGGALALVAAALNPRIQKTVAIYPFLSDFRRVIEIGNTSEAYDELFRYFKF---------------YDPFHETEEEIMATLAYID--VKNLAHRIQGEVKMITGLDDDVCYPITQFAIYNRLTC---DKTYRIMPEYAH.................................................................. 300
4 -22.800PF10142.9; A3HWH7_9BACT/44-408; PhoPQ-activated pathogenicity-related protein  ali follow..  10TAFKFEVVRTVTGQDYDFHVLKMTIVVPRETSFETGLMWIGGGSTKTKPEEPDQLILQAALQSNSIVAQVH--------------------------------------------NIPFQPLTFKNDPEGARTEDAIIAYGWRKFLEGGAKDEDAIWRLPMTKAVKLAMDATSEIAKTYYDINLKNYVVAGASKRGWTTWTTAAVDDRVVAIIPIVIDMLNLEPSFKHHWKNYGFWAPAVGNYVSEGIMEWMGTPEFDRLLEITEP---------------YSFLPELDMPKLLINAAGDQFFQPDSWEFYWNDLKG---EKHVQYVPNFGH------DLSQSDALPNMVSFYSSVINE-----------IERPKYQWSIEGDRISFQADSSNQPISV 351
5 -22.700PF08840.11; ACOT1_MOUSE/203-410; BAAT / Acyl-CoA thioester hydrolase C terminal  ali follow..  12  3.....................................................................................................................................................................MEYFEEAVNYLRSHPEVKGPGIGLLGISKGGELGLAMASFLKGITAAVVINGSVAAVGNTISYKDE---------------TIPPVTILRNQVKMTKDGLKDVVDALQSPLVDKKSFIPVERSDTTFLFLVGQDDHNWKSEFADEISKRLQAHGKKPQIICYPAAGHY-GEPKPHAMAQLDAQLQTFFHKQLGS....................................... 208
6 -21.200PF12697.7; B7FWY9_PHATC/125-380; Alpha/beta hydrolase family  ali follow..  10...............................SAVPVYHLLGGTQYEKNGQQSRSLMEALLAKLQPYTMDFRGFGGTHADETGYVEPSRC---------------------------------------------------------------------------VQDTEVVLEWIARRHGMVGKEFPALFGWSQGALVAQLVAQKTRPLMSKLILYGSIYDPMVRYPREPLYSTSKPNRTVIENTFDNAIEDFTIEGSIAPEPARLFAEAALQSDPVKAVNNCDPGRVHVPTLVVAGDQDPYAPLHVQQELFCNLGRAS-DRTWSILADSDHA................................................................. 243
7 -18.300PF00756.20; SFGH2_ECOLI/21-271; Putative esterase  ali follow..  13  4..............LNCPMTFSIFLPPPRDHTPPPVLYWLSGLTCNDENFTTKAGAQRVAAELGIVLV---------------------------------------------------------------MPDTSPRGEKVANDDGYDLGQGAGFYLNATQPPWATLRDELPALVQSQFNVSDRC-AISGHSMGGHGALIMALKNPGKYTSVSAFAPIVNPCSV-----------------------------WGIKAFSSYLGEDKNAWLEWDSCALMYASNAQD-AIPTLIDQGDNDQFLADQQPAVLAEAARQKAWPMTLRIQPGYDH.................................................................. 236
8 -18.300PF10503.9; B4EN12_BURCJ/70-289; Esterase PHB depolymerase  ali follow..  13  1....................LAYGLYVPPRRGAMPLVVMLHGCQQSVDEFAQGTRMNLLADKHGFAVLYPE----------------------------------------------------------------QSLRAHAHGCWHWYEDTDRAGRGEANAVVSL-----VDALVDEHG-FDASRVYVAGLSAGAGLASLLALHHPDRFAAVALHSGPAL---------------------------------EANSGITAMDVMRRGLRQNPAAAVDALVEGGAYPGMPALIVQGDGDHVVAPKNADQLTVQFMRLN............................................................................... 199
9 -17.900PF02273.15; C7BN06_PHOAA/8-301; Acyl transferase  ali follow..  3........IDHVICVEENRKIHETLPKENSPKRKNTLIIASGFARRMDH--FAGLAEYLSQN-----------------------------------------------------------------------GFHVIRYDSLHHVG----LSSGTIDEFTMSIGKSLLAVVDWLNTR----KINNLGMLASSLSARIAYASLSEIN--VSFLITAVGVVNLRYTLERALGFDYLSLPIDELPDNLDFEGHKLGAEV----------RDCFDSGWEDLTSTINSMMHLDIPFIAFTANNDDWVKQDEVITLLSSIRS---QCKIYSLLGSSHDLGEAAIAMDNGCLDIDVDIIEPSFEHLTIAAVNERRMKIEIE....................... 293
10 -17.400PF01738.18; DLHH_METEA/65-289; Dienelactone hydrolase family  ali follow..  11  4......................YRAMPAEGGPFPTILVVQEIFG----HEHIKDVCRRLAKL-GYFALAPELYA----------------------------------------------------------------RQGDVSTLTNIQQIVSEVVSKVPDAQVMSDLDAAVAFAKGTGKADTARLGITGFCWGGRITWLYAAHNPAVKAGVAWYGRLVG--------------------------------------------------DSSALMPKNPVDVAADLKAPVLGLYGGADQGIPVATIDRMKEACRAAGKTCDFVVYPEAGH--PSYRAEPAQDGWKRLQDWFRQY.......................................... 224
11 -15.700PF06500.11; Y674_VIBPA/4-414; Alpha/beta hydrolase of unknown function (DUF1100 topsan)  ali follow..  166KQIEVP----------QKRKIIANLHLPRTDKQLPVVMVSAGLDSLQTDMWRLFRNHFAPKDIAMLTV---------------------------------------------------------------------------------------DMPSVGHSSHWCLHQAVLNELYSIPYVDHHKVGLVGFRFGGNAMVRLSFLEQEKIKACVALGAPVHDL-------------FTSPKKLQKMPKMYLDMLASRLGKSAVDINSMAGQMMAWSLKVQGFLSSRKTKVPILALSLEGDPVSPYSDNQLVALFSH----YGQAKKISSKTITKGY-------QSLDLAIKWLEDEL......................................... 410
12 -15.600PF12048.8; C5BPB2_TERTT/18-334; Protein of unknown function (DUF3530 topsan)  ali follow..  10  53...ELSKEEVVWLEGGAD-KFPAVWKADTSGDPFGAILLIHGAGQTLDPSSLHELRNSLTDFWSTLSISLPQPDLPPAPPRPSALPAENPTPTDGIAT----------------------------------------------------NDDDATTPELSPEITARLQAAVAYLNSR----GQYNLAIAGEDVGALWATQYVARLARDFAGSKKNRPRGKVNAKM----------------------------SRPVRALILINARNSVPYQTGVPEKNLSDWFNDPGLPILDVYFGSHFLDEKEPAIRAKNARRKRLTDYVQLQLIDSPI-----SSGGETQLSRRVRGFLNK........................................... 317
13 -15.500PF02230.16; LYPA1_RABIT/11-226; Phospholipase/Carboxylesterase  ali follow..  16  2........................AVVPAARKATAAVIFLHGLGDTGHG-------AEAFAGIKSPHIK---------------ICPHAPVMPVTLNMNMAMPSWFDIVGLSPDSQEDES----------------------------------------GIKQAAETVKALIDQEVKNG-IPSNRIILGGFSQGGALSLYTALTTQQKLAGVTALSCWLPLRASF----------------------------------------------------SQGPINSANRDISVLQCHGDCDPLVPLMFGSLTVERLKALINPAN---------VTFKIYEGMMHSSCQQEMMDVKHFIDKLL..................................... 216
14 -14.900PF03583.14; LIP10_CANAL/118-408; Secretory lipase  ali follow..  10  20...............................................................................................................................VPLLQNGYYVIIPDYEGPKSTFTVGRQSGK------ATLNSIRAALQTGAFSGIKKTAKVALWGYSGGSWAISLQSKYAPELKENLIGAAVGGFATNITAVAEAVDGTVFSAASLVGYPMSQYFTGQNRAFEKGWGLLQDEVFNKTIEDNLLLKLDKTYLPQVPVLIYHGTIDEIIPIKDANAQYQIWCDRGIQLEFAEDLSAGHL................................................................. 265
15 -14.800PF03096.14; NDRG2_HUMAN/40-318; Ndr family  ali follow..  10  10...................SVTFTVYGTPKPKRPAILT-YHDVGLNYKSCFQPLFQQEIIQNFVRVHVDAPGMEEGAPVFP----------------------------------------------------------------------------LGYQYPSLDQLADMIPCVLQY---LNFSTIIGVGVGAGAYILARYALNHPDTVEGLVLINIDPNAKGWMDWAAHKLTGLTSSIPEMILGHLFSQEELSGNSELIQKYRNIITHAPNLDNIENFERGGDITLRCPVMLVVGDQAPHEDAVVECNSKLDPT----QTSFLKMADSGGQ---PQLTQPGKLTEAFKYFLQ............................................ 273
16 -14.600PF06342.12; Q9N4E2_CAEEL/23-319; Alpha/beta hydrolase of unknown function (DUF1057 topsan)  ali follow..  13  10.........KFETESGKKVELDVYEDSLTSGSPFGTVVAFHGSPGSHND--FKYIRSKLDDLIRFIGVNYPGFTFTNEYPD----------------------------------------------------------------------------QKHINIERQNYSNALLDELG------DGKMAYIGHSRGCENALQTAVARDAHGIVLINPTGLRIHKGINPISRMTTVDSIYKMLPLFLGNAMMLGVYKAFGFKITTGEEAVNSMRSMINVSLGGIEKTNDMNVKKLIVFAGKDHLVEEEIVFETLEKHEGLQHLKILDSFTGTQRGASVFVAQDNHFQNKSRAGLVAEACKAMFE.................................... 297
17 -13.800PF08538.10; Q5KNQ0_CRYNJ/1-293; Protein of unknown function (DUF1749 topsan)  ali follow..  12  6...........QLTTIPCGPFFYPVFTSGDLTATRAVVFIGGLTNGGAVPFTYPLSDALGKA-----------------------------------------------------------------------GWKLIQFHWSSAYGGYGTGSLDR-------DREEMQALVKYLKTT---GGLSKVIIMGHSTGSQNVMHYLSSSINHVDGGIMQAPVSDREVCAKDKPYCDYLSAGFGGVEMKMTAYRLWSLMGVGGDDDYFSADIPLEPTQPYVHSL-STSFGALTAPALALFSEKDAEWIVARPEDLLPKWADAA-KLEWRIIKGASH------KEAQAVLCEDVLSWLR............................................ 293
18 -13.600PF05728.12; Q32BT7_SHIDS/4-188; Uncharacterised protein family (UPF0227 topsan)  ali follow..  13  1....................................LLYLHGFNSSPRSAKASLLKNWLAEH-----------------------------------------------------------------------HPDVEMIIPQLPP-----------------YPSDAAELLESIVLE---HGGDSLGIVGSSLGGYYATWLSQCFML--AVVVNPAVRPFELLTDYLGQ------------------------NENPYTGQQYVLESRHIYDLKVMQIDPL----EAPDLIWLLQQTGDEVLDYRQAVAYYA-------SCRQTVIEGGNH.................................................................. 169
19 -13.400PF12146.8; A6X2Y7_OCHA4/35-272; Serine aminopeptidase, S33  ali follow..  1..............................GKPKGVIVLLHRGHEHSGR--VAHLVDELGLD-----------------------------------------------------------------------DYAFYAWDARGHGSPGVRGFSPSFGAS----IRDLDSFVAHIRQETGTAI-EDVAIIAQSVGAVLAAAWVHDYAPNIRALVLASPAFDIKLYVPFAKEGIGLWQKLKGTFYVNSYVKPQFLTHDPERIESYRTDPHILLQLYETAKRVVDDARAITVPTQLLISGSDFVVRPAPQHRFFENLGSRIKERHV-------------LKGFYHDT..................................................... 233
20 -12.900PF02129.18; Q5NNB9_ZYMMO/74-359; X-Pro dipeptidyl-peptidase (S15 family)  ali follow..  11  1...............................................................DGVKLHTVIV----VPKNGRNLPILLTRTPYDAS-----------SRTSRSDSPSMLATLPEGDEVFVRDGYIRVFQDVRGKYGSETRPPVGDLNPTKVDHTTDAWDTIEWLTKHIPESN-GRVGMIGSSYEGFTVVAALLNPHPALKVAAPESGAFRQAAFDYFLRQMTAKGTGAPPVHGAYDDYKAQRLSIHPAYDKFWQG----------QALDQLVAAHPSHVPTMWIQGLWDQE--MWGAIHSFESLKNAGHIDTNYLVMGP-----------RHS...................................................... 285
21 -12.700PF12715.7; R6DAX6_9BACE/29-421; Abhydrolase family  ali follow..  84EKWEFYPLPECVSTF-------LVLIPDSLRQPVPAILCIPGSGGSKEARNFAKAGYVAVAV-GYVAVAVDNPAAGEASDLERYARGRNYNYDLVSRILLEL-------------------------------------------------------WNYLGYTSFLDMQVLQWMKTQ-SYIRKDRIIVSGFSMGTEPLMVLGTLDTSIYAFVYNDFLCHTQERA------------------------LVMTAPDKTGIRPFPNSIRHLIPDFWRKFNFPDIVASLAPRPVILTEGGLDRDLD--LVRAAYKMTGRLE-NVEIHHYPKYADPHSRTDIK-------ALPEGLDRNEFYKLVNVDGANHYFKSELI...................... 385
22 -12.200PF05677.12; Q9Z6X9_CHLPN/13-370; Chlamydia CHLPS protein (DUF818 topsan)  ali follow..  106......SAADRVVIQYDDLVVDSLAIKIPHALPHRWILYSQGNSGLMENLFGDSSLHQLAKATGSNLLVFNYPGIMSSKGEAKRENL-----------------------------------------------------------------------------VKSYQACVRYLRDEETGPKANQIIAFGYSLGTSVQAAALDREVGTSWIVVKDRGPRSLADV----------------------------------ANQICKPIASAIIKLVGWNIDSVKPSERLRCPEIFIYNSNHELISDGLFERENCVATPF---LELPEVKTSGTKIPIPERDLLHLLSPNVVDRLAAVISNYLD.................................... 358
23 -12.100PF05705.14; A8WVS3_CAEBR/69-317; Eukaryotic protein of unknown function (DUF829 topsan)  ali follow..  2....................................VVLMVGWAGANPKHIDKYIKIYNDEGYRVVSLCPPCYHYSIPNSRVGF-------------------------------------------------------------------------------YISPLFRAVDSKAGDFRSFSQCPIVIHSFSMNGVRGLISPELRGRIKGIIFDSARPYGKQDATAMVISTPPIDALERWISEQTRISMLTWFLNLRATLQIPLLAVVPFLRSFMSIYYYLQTHITLPRDQLYLYSKADTMIKAKHVEKFINKQKEKGNSVTAIDFVDSDHVA---IRTHPEEYRSACLNFV............................................. 249
24 -11.600PF06057.11; Q8PB04_XANCP/266-453; Bacterial virulence protein (VirJ)  ali follow..  11  3...................................FAIFVSGDGGWAGLD--EEVADALVAQ-GIPVVGLDSLRYFWSERTPQGF-------------------------------------------------------------------------------ATDLDRIARFYAQR---WQRRRVVLIGFSQGADVLPAAINKLPAPTKQNLRMTALLSV-----------------------------------GKLADYEFHVSNWLGSDDDGLPIAPEVQRLPPGITVCIYGQDDEDALCPSLPA----------TAKRVVLPGDHHFKGDY-----ATLAKVIMEQLH............................................ 187
25 -11.100PF04301.13; Q9CJT9_PASMU/1-213; Protein of unknown function (DUF452 topsan)  ali follow..  10  17............................................................................................................................................................FAGWGTPPSV-LCYDYRDLHCDVDFSAYQHIRVVAWSMGVWVAERVMQGYPLLSATAINGTGLPCDDQYGIPEAIFA--GTLSGLNEDNRTKFERRICGSKTLLRDYQHYSMRPTLQEIHAELTALYTFLDLISWSKAIVGSKDKIFPAQNQRAYWQ-------DRCAITEIAGEHL................................................................. 202
26 -10.400PF05577.12; YM67_CAEEL/65-499; Serine carboxypeptidase S28  ali follow..  18  4........DHFDSSVGKTFQQRYYHNNQWYKAGGPAFLMLGGEGPESSYSYPGLEITNLAAKQGAWVFDIEH--------------------------------------------------------------------RFYGETHPTSDMSVPNLKYLSSAQAIDAAAFIKAMTAKFPQLANAKWVTFGGSYSGALAAWTRAKHPELVYAAVGSSGPVQAEVDF............................................................................................................................................................................ 156
27 -10.200PF07224.11; CLH1_CITUN/19-322; Chlorophyllase  ali follow..  28...............SPPPPKPLIIVTPAEKGTFNVILFLHGTSLSNKS--YSKIFDHIAS-HGFIVVAPQLYTSIPPPSATNELN-----------------------------------------------------------------------------SAAEVAEWLPQGLQQNTEANVSLVAVMGHSRGGQTAFALSLRYGFGAVIGLD--------------------------------------------------PVAGTSKTTGLDPSILSFDSFDFSIPVTVIGTGLGGVARCANHEEFFNRCK--NSSRAHFVATDYGHMD----DPMRRCVSGIVVAFLKDFFDGDAEDFRPSFAPIKLDSVEYIDASSML............. 304
28 -9.880PF07859.13; B8NHZ6_ASPFN/82-288; alpha/beta hydrolase fold  ali follow..  12  1.....................................LYFHGGG--GGVNEEDGFCRVISRQCQMRLVSVEY-----------------------------------------------------------------KAPETRYPGALN-----------------DGVSAALWALSR---YENQPLILMGTSAGGNLAFGTALRLID-VSGVVALAPITVHPDAVPEHLKEQYTAYEENAELTVNSRAAMQVFFDCYKAP----VDDVYTSCLLHPRLLAL-------PKVYIAELGLDTL---DDARLMKGALDTAKVPVMYDAYPGYPH.................................................................. 204
29 -9.710PF12740.7; I1IT26_BRADI/46-300; Chlorophyllase enzyme  ali follow..  1.................TPPIPVLIVAPKDAGTYPVAMLLHGFFLQNHY--YKQLLRHVA-SHGFIMVAPQFHLSMIPTGDTKDIEAAAKVSDW-------------------------------------------------------------------------LPEGLPSVLPKGVEPELSKLALAGHSRGGHTAFSLALGHAKSFSALIGIDPVAGTGKSSQLAPKILTYEPSSFNMSAAMPVLVIGTGLGEEKKNIFTPPC-----APKDVNHREFYLECKPPCYYFVTKDYG------------HLDMLDDDAPMVITCLCKDGGSCKDKMRRCVAGI---MVAFLNSALG........................................ 248
30 -9.390PF05576.11; Q9RDG7_STRCO/27-474; PS-10 peptidase S37  ali follow..  18  32FVLNYTQPVDHRHPSKGTFQQRITVLHKDVNRP--TVFYTGGYNVSTNPSRRE-----PTQIVDGNQVSMEYFT-----------------------------------------------------------------------------PSRPAPADWSKLDIWQAASDQHRIFKALKPLYSKNWISTGGSKGGMTATYYERFYPRDMDGVVAYVA.................................................................................................................................................................................... 167

FFAS is supported by the NIH grant R01-GM087218-01
1 3 8 7 1 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Friedberg I. and Godzik A Connecting the Protein Structure Universe by Using Sparse Recurring Fragments. Structure (Camb.) (2005) Aug;13(8):1213-24