current user: public

If you have questions about the server, please let us know.

Query: PF11695.8; Q9A5F4_CAUVC/31-168; Domain of unknown function (DUF3291 topsan), from PfamA32U

Results of FFAS03 search in PfamA32U
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .
# Score Template Links and tools%idFirst LAQVNVGRLKAPIDHPMIKDFADNLDRINALAEASPGFVWRLTGEGNNATDLAIDSDPLFIPNLSVWSDIPSLGAFVYRSGHVEIMRRRREWFEHMDLYMALWWVPAGHTPTVEEALEKLAHLEAHGPTPAAFTFKVPLast
1 -84.400PF11695.8; Q9A5F4_CAUVC/31-168; Domain of unknown function (DUF3291 topsan)  ali  100  1LAQVNVGRLKAPIDHPMIKDFADNLDRINALAEASPGFVWRLTGEGNNATDLAIDSDPLFIPNLSVWSDIPSLGAFVYRSGHVEIMRRRREWFEHMDLYMALWWVPAGHTPTVEEALEKLAHLEAHGPTPAAFTFKVP 138
2 -14.500PF03992.16; HMOB_BACSU/65-140; Antibiotic biosynthesis monooxygenase  ali follow..  13  3.....AVLNNIAVTQEGRPLFENRFKNRAGKVENEPGFE---------AIRVLRPLDSDTYVILTLWETESAFQDWQQSGSYKEAHKK.................................................. 76
3 -13.800PF13826.6; G7XTL7_ASPKW/119-243; Domain of unknown function (DUF4188 topsan)  ali follow..  10  1IVVFHLGARNHHPLGMFAPGMKELGDSAEKMQRVKYGLLGSSQWLKCDSAA------GNEFMTVFYLRDYAALHQFAHDEIHMEGVRWWARIAKD-HPHLALY................................... 102
4 -11.300PF16291.5; Q65N75_BACLD/114-202; Domain of unknown function (DUF4937 topsan  ali follow..  16  1.....LKLIRCKSAEQKLQAF-SEAQAKWAPLQNVSGFIRQWGG--------METEDGPEAVVLALWKSKHDYLNFM-AEHHDEIYERTHQ............................................... 77
5 -9.620PF07876.12; Q8LQD2_ORYSJ/11-106; Stress responsive A/B Barrel Domain  ali follow..  10  1VKHILLARFKEDVAPERLDQLIRGYAGLVDLVPSMKAF------HWGTDVSIENMHQGFTHVFESTFESTEGVKEYIEHPAHVEFANEFLPVLEK........................................... 89
6 -9.160PF08803.11; Q7CGF9_YERPE/4-99; Putative mono-oxygenase ydhR  ali follow..  13  1.....ILQVDFPYTGPWGNEMTKAMEGLARSIAEEPGLIWKI---------WTVNETTNEAGGIYLFSDISAAKAYLAM........................................................... 65
7 -8.180PF16157.5; H2J0N4_RAHAC/1-172; Domain of unknown function (DUF4865 topsan)  ali follow..  3AMQYSFTL-----ADYDMGIIEKRIADNGYRTDGFAGLIFKT----SRRDCPQTGSAENIYAPFYLWQDVSGMNRFISGAGFQGVANA.................................................. 85
8 -7.990PF07682.11; F4B4D5_ACIHW/1-294; Sulphur oxygenase reductase  ali follow..  14  3.........ELKNEPKTFEMFASVGPKVCMVTARHPGFVGFQN--GGAKMDMTKESSSVRVLQYTFWKDWKD-----HEEMHRQNWSYLF------------------------RLCYSCASQMIWGPWEPIYE.... 109
9 -7.220PF13816.6; L2FQ62_COLGN/47-355; Haem-containing dehydratase  ali follow..  175LCVIRSGQDWSAALPEERQIYLDSMQPPLTRGGDEVGCISCRFMDVVDPVT--AEGGTDRTFCLAYFDNLSSLESWSKEHRHLAIFGEFAKYAKRGDKMSLSLFHEVLVLEAEQQMFEYIGCHDGTG........... 308
10 -6.950PF18869.1; A0A1F7Z354_9BACT/11-156; RnaseLS-like HEPN  ali follow..  11  12..LLRESVLLISTFGKWSKRFHDYAFIVFPAAKAYEGFLKTLFRDLGFISDETYFGKRFRVGKANHYREESIYDMLENYCQGKELPDALWETWKRGRNMLFHWFPNESNVISYGDAKQIIFEILE............. 140

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 2 0 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Veeramalai M, Ye Y, Godzik A. TOPS++FATCAT: fast flexible structural alignment using constraints derived from TOPS+ Strings Model. BMC Bioinformatics. 2008 Aug 31;9(1):35