Scheduled maintenance will begin on May 30th, 2025. Server will be temporarily unavailable — learn more.
current user: public
If you have questions about the server, please let us know.

Query: PF11798.8; DPO4_TREDE/168-199; IMS family HHH motif, from PfamA32U

Results of FFAS03 search in PfamA32U
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30
# Score Template Links and tools%idFirst AGEEIDFMKSLPLKDVWGVGGKTRERLIAAGLLast
1 -24.200PF11798.8; DPO4_TREDE/168-199; IMS family HHH motif  ali  100  1AGEEIDFMKSLPLKDVWGVGGKTRERLIAAGL 32
2 -8.330PF11731.8; B3ENR7_CHLPB/7-91; Pathogenicity locus  ali follow..  23  7...........KLTDLPNIGPAIAADLRLLGI 27
3 -7.930PF04994.13; Q7MJ56_VIBVY/114-195; TfoX C-terminal domain  ali follow..  33  1........KPERLKDLPNLRLATERMLKKAGI 24
4 -6.770PF02961.14; C3XZ01_BRAFL/2-89; Barrier to autointegration factor  ali follow..  32  15.......MGDKPVTALAGIGGTLGGRLEEEGF 39
5 -6.630PF17191.4; A8F350_PSELT/110-273; RecG wedge domain  ali follow..  23  1...........EIKYAKRVGPRKEAILKKLGI 21
6 -6.560PF10391.9; G0RCE3_HYPJQ/462-510; Fingers domain of DNA polymerase lambda  ali follow..  40  3............FLGIYGVGNKVAEQWIAQGW 22
7 -6.030PF09271.11; S2K0N6_MUCC1/331-498; LAG1, DNA binding  ali follow..  29  14.GTEKRFLCPPPTAILVG.............. 30
8 -5.810PF13338.6; D2NT20_ROTMD/74-122; Transcriptional regulator, AbiEi antitoxin  ali follow..  29  6AAELHPFVLNSQMLNLRGIGPKRIRKLVAEG. 36
9 -5.430PF14229.6; C7RPT7_ACCPU/9-129; Domain of unknown function (DUF4332 topsan)  ali follow..  21  43PRVILELANRADLARIKGVSGVYSDLLEKAGV 74
10 -5.220PF14520.6; E1R1J7_SEDSS/72-131; Helix-hairpin-helix domain  ali follow..  33  39............LSSIPGVGKKSAGKI..... 53
FFAS is supported by the NIH grant R01-GM087218-01
1 4 8 0 9 7   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Ye Y, Jaroszewski L, Li W, Godzik A. A segment alignment approach to protein comparison. Bioinformatics. 2003 Apr 12;19(6):742-9.