|
current user: public |
|
Query: PF11858.8; RNH3_OCEIH/3-77; Domain of unknown function (DUF3378 topsan), from PfamA32U |
. 10 . 20 . 30 . 40 . 50 . 60 . 70 . | |||||||
# | Score | Template | Links and tools | %id | First | QQVIVTTKEQIQKMKKYYLSQLTSTPQGAIFRAKTNNAVITAYQSGKVLFQGSAPESEASKWGNVPLNDKKKHSL | Last |
1 | -49.300 | PF11858.8; RNH3_OCEIH/3-77; Domain of unknown function (DUF3378 topsan) | ali | 100 | 1 | QQVIVTTKEQIQKMKKYYLSQLTSTPQGAIFRAKTNNAVITAYQSGKVLFQGSAPESEASKWGNVPLNDKKKHSL | 75 |
2 | -10.900 | PF00352.21; Q74N53_NANEQ/26-117; Transcription factor TFIID (or TATA-binding protein, TBP) | ali follow.. | 11 | 53 | .................................GMHTISILLFRKGPIIVSGVTKKEHLI............... | 79 |
3 | -9.870 | PF15935.5; I5B0B2_9DELT/91-316; RNase LS, bacterial toxin | ali follow.. | 14 | 9 | ....KIKQDDFELLLEYLDTEENNHTIFKISSIYKDETTLTQYANQTILLQGR...................... | 70 |
4 | -7.550 | PF14729.6; Q2G174_STAA8/25-118; Domain of unknown function with cystatin-like fold (DUF4467 topsan) | ali follow.. | 14 | 6 | ........DKVYKEQNQMNKIASKVQNTIKTDIKQEDSNTHVYKDGKVIV......................... | 47 |
5 | -6.110 | PF05224.12; Q6CIS1_KLULA/102-323; NDT80 / PhoG like DNA-binding family | ali follow.. | 12 | 199 | .....................................VPILMEKTPPLIIRGRSPSNYCQQ.............. | 222 |
6 | -5.750 | PF14466.6; R6Y7E1_9BACT/10-135; PLAT/LH2 and C2-like Ca2+-binding lipoprotein | ali follow.. | 40 | 111 | ....................................KVLVTAYIDGKEVNQ........................ | 125 |
7 | -5.680 | PF12229.8; Q24UT7_DESHY/59-158; Putative peptidoglycan binding domain | ali follow.. | 16 | 30 | PSVLAIDYVMANQVLHEKLAEFNRSAVDASFKIENDQFKITPAISGEAV.......................... | 78 |
8 | -5.660 | PF06006.12; YUBL_YERPE/6-74; Bacterial protein of unknown function (DUF905 topsan) | ali follow.. | 26 | 7 | ....TFTREQAEVVAAQYTNVAIEDDQGAHFR-------LVVRQNGEMVWRTWNFEPGGTYWLN........... | 59 |
9 | -5.650 | PF18545.1; W0JWR0_9EURY/36-109; Halobacterial output domain 1 | ali follow.. | 7 | 34 | ...........EALDDLFTETAAEGLRNGNLSFSYEGFDVTAFSRGTIEIS........................ | 73 |
10 | -5.440 | PF06195.13; F7YUD8_9THEM/29-156; Protein of unknown function (DUF996 topsan) | ali follow.. | 9 | 7 | .ILFLVAVNNIAKIVEDQNVFTYFLIPTILWFVALVVISVTLMSSFGLIMMGR...................... | 58 |
FFAS is supported by the NIH grant R01-GM087218-01
|
![]() ![]() ![]() ![]() ![]() ![]() |
Selected papers from Godzik Lab Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9. Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018. Li W, Godzik A. cd-hit: a fast program for clustering and comparing large sets of protein or nucleotide sequences. Bioinformatics. 2006 May 26; |