current user: public

If you have questions about the server, please let us know.

Query: PF12147.8; Q2K5I6_RHIEC/285-593; Putative methyltransferase, from PfamA32U

Results of FFAS03 search in PfamA32U
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .
# Score Template Links and tools%idFirst VRRFIDARFAEPRAPADLRTAHVQGYTKDEADRLASPLDATSPRGIYWALSRLNIRLGALASEGIKTGVKTGFDSGSTLDYVYENKPRGLGPGGRLIDKVFLEAIGWRGIRQRKLHLQELIEYGLKRLKAAGRSTHLLDIAAGHGRYVLDAIEAAGVRPDSARLQDYSPINVDAGRNSIARRGLNDFVSFHQQDAFDGEGLAAITPAPDLAIVSGLYELFSDNAMIAASLSGIARAMQPGGLLIYTNQPWHPQLEMIARALTSHRGGQAWVMRRRTQEEMDQLVAAAGFRKLEQRIDQWGIFTVSLAERLast
1 -93.200PF12147.8; Q2K5I6_RHIEC/285-593; Putative methyltransferase  ali  100  1VRRFIDARFAEPRAPADLRTAHVQGYTKDEADRLASPLDATSPRGIYWALSRLNIRLGALASEGIKTGVKTGFDSGSTLDYVYENKPRGLGPGGRLIDKVFLEAIGWRGIRQRKLHLQELIEYGLKRLKAAGRSTHLLDIAAGHGRYVLDAIEAAGVRPDSARLQDYSPINVDAGRNSIARRGLNDFVSFHQQDAFDGEGLAAITPAPDLAIVSGLYELFSDNAMIAASLSGIARAMQPGGLLIYTNQPWHPQLEMIARALTSHRGGQAWVMRRRTQEEMDQLVAAAGFRKLEQRIDQWGIFTVSLAER 309
2 -35.400PF06080.12; Q8YZS2_NOSS1/8-210; Protein of unknown function (DUF938 topsan)  ali follow..  14  4..........................................................................................................APATQRNREPILEVLLQVL------PASGTILEIASGTGEHAIFFAPRLK--PRKWLPSDPNPELRASITAWIAQFPSDNLYPPVELDASQPRDAILQDAPIAAIVNINMIHISPWSA-CLGLLAGAGRILPPGGILYLYGPQGGEHTAPSNAAFDESLRSQNPEWGVRNLEDVIAAAKQQNLQLHKTYQMPAN-NLSVVFQR 203
3 -33.900PF01209.18; COQ5_YEAST/56-306; ubiE/COQ5 methyltransferase family  ali follow..  16  4....................................................................................LKSTKQKLVGDVFSSVANRYDLMNDV--MSLGIHRLWKDHFINKLDATTPLNFIDVAGGSGDIAFGLLDHAESTESTMDIVDINPDMLKEGEKRAMEQGKYPRVRFLVSNGEKLEEID--SDSKDIYTVSFGIRNFTD---IQKGLNTAYRVLKPGGIFYCLEFSKIENLPVMGSMIANDYDSYQYLVRFPDQETFKSMIEKAGFKSAGYESLTFGICAIHWGIK 251
4 -32.000PF03291.16; MCES_YEAST/109-424; mRNA capping enzyme  ali follow..  10  1.................................................................EMTANRSINVDQIVREHYNE-------RTIIANRAKRNLSPIIKLRNFNNAIKYMLIDKYTK-----PGDVVLELGCGKGGDLRKYGAA---GISQFIGIDISNASIQEAHKRYRSMRNLDQVVLITGDCFGVEPFPDCRFPCDIVSTQCLHYAFETEEKARRALLNVAKSLKIGGHFFGTIPDSEFIRYKLNKFPKEVEKPSWGNSIYKPFETLRSLADEYGLELVSQM.............. 262
5 -31.700PF13847.6; B2J9C6_NOSP7/55-253; Methyltransferase domain  ali follow..  16  3....................................................................................................................................KEKVILDAGCGTGYKSLVLAEANP--GAKIVGIDISEESIKLAQQRLEHHGFDN-AEFHVLPI---QELPKLNYQFDYINCDELLYLFPDLA---AALQGMISVLKPNGIIRSNLHSSIQRFPYFRTMMGLMDENPQDLEMEIVVETMKALKDNVELKARTWN.............. 161
6 -30.800PF08003.11; CMOB_VIBVY/7-322; Protein of unknown function (DUF1698 topsan)  ali follow..  10  67...................................................................................QGELKKLESLLRTFHPWRKGPYTVHGIHIDTEWRSDWKWDRVLPHISPLKNRSVLDVGCGNGYHMWRMLGE---GARLCVGIDPSHLFLIQFEAIRKLMGGDQRAHLLPLGIEQLPK----LEAFDTVFSMGVLYHRRSPL---DHLIQLKDQLVSGGELILETLVIEGDETAVLVPKERYAQMRN-VYFFPSARALKVWLELVGFEDVRIV.............. 267
7 -30.500PF05401.11; Q98A39_RHILO/5-200; Nodulation protein S (NodS)  ali follow..  17  24.....................................................................................................................RERHTQILRLSLAQGRVANALEVGCAAGAFTERLAPICQ----RLTVIDVVEPAITRARLRMKET---PHISWIISDVQQF----SSDELFDLIVVAEVLYYVGDLVQIRAAVRNLVGLLAPGGQLVFGSA............................................................. 143
8 -30.500PF13649.6; D8K355_DEHLB/33-128; Methyltransferase domain  ali follow..  23  1........................................................................................................................................VLDVCCGTGDQAIRLAE----QGIEVHGIDLNGSMLATAESHKRRAGLDN-VSFGQADA---SALLFPNRSFDYATTSLALHEKPREVQ-LQVLEEMRRVVKKGG.................................................................... 96
9 -30.200PF05891.12; NTM1_ORYSJ/61-283; AdoMet dependent proline di-methyltransferase  ali follow..  11  44.........................................................................................................................PLLAERFGAARRHLVALDCGSGIGRVTKNFLLRHFN---EVDLVEPVSHFLEAAQENLTECMEVGEDTHKAANFYPLQDFTPDEGRYDVIWIQWCIGQLPDDD-FISFFNRAKIGLKPNGFFVLKENIARNGFVLDKEDNS----------ITRSDAYFKELFKKCGLYIHSIKDQPKELFAVKM... 219
10 -28.700PF11968.8; A1C9Q5_ASPCL/61-283; 25S rRNA (adenine(2142)-N(1))-methyltransferase, Bmt2  ali follow..  11  1..............................................................................................RELDARIEASGGLESYQLASKLLIDWIGPNLVELKHSPFKLRMLEVGALSTKNACTR-----SYLFDVTRIDLNSQEPGILKQ----------------DFMKRPLPRADNDRFHIISLSLVLNYVPSAIGRGDMLKRCVEFLTDKLPSGLS-------LNIRPNLFLVLPLACVKNSRYLTEGRLQDILSSMGFVLAKSKETSKLIFQLWEHNG 200
11 -26.800PF03848.14; TEHB_HAEIN/91-282; Tellurite resistance protein TehB  ali follow..  12  19.........................................................................................................................HGDVVDAAKIISPCKVLDLGCGQGRNSLYLSLL----GYDVTSWDHNENSIAFLNETKEKENLN--ISTALYDINAAN----IQENYDFIVSTVVFMFL-NRERVPSIIKNMKEHTNVGGYNLIVAAMSTDD........................................................ 139
12 -26.700PF01234.17; INMT_MOUSE/1-260; NNMT/PNMT/TEMT family  ali follow..  14  19.............................................................................................KDYLTTYYSFHSGPVAEQEIVKFSLQNLYQTFST--GGVGGDVLIDIGSGPTIYQLLSACEVFR---EIIVTDYTPQNLQELQKWLKKEP-RTVTRVLRCDVTKTPPLSAQVPLADCVLTFLAMECAPDIDTYRAALRRLAGLLKPGGHLVTLVTLRFQHYMV---------GPKKFSGVYLEKEVVEKAIQDAGCQVLKCNCVSLS-LCFVVARK 260
13 -26.300PF08241.12; Q83DM1_COXBU/77-169; Methyltransferase domain  ali follow..  19  1.........................................................................................................................................LDIGCAKGFLVKDFMKACP--GLEAYGIDISEYALMNCEPEVVG-------RLHLGNA---DHLPFPDNSFDAVISLNTVHNLPRER-VIIALREIQRVSGGKAYI.................................................................. 93
14 -25.500PF05148.15; RRP8_CAEEL/125-343; Hypothetical methyltransferase  ali follow..  12  12.......................................................................AGRFRFLNEKLYTCTGSEAFDFFK--DPTAFDLYHKGFADQVKKWPNHPLREIIRWLQSKPDQQSVFDLGCGEAKIAEAVGEKH-----KIRSFDLVAVNDRVESC-------------------DMSKLPAEDSSADIVIYCLSLMGTNLYD----FIREARRVLKIGGILKIAEVTSR----------------------FVSIKQFCEAITKMGFEQSHRRELTDYFMMMEFKKV 198
15 -25.500PF05219.12; METL9_HUMAN/56-317; DREV methyltransferase  ali follow..  11  68..............................................................................................................RGSMFVFSPDQFQRLLKINPDWKTHRLLDLGAGDG----EVTKIMSPHFEEIYATELSETMIWQLQKK---------------RVLGINEWQNTGFQYDVISCLNLLDRCDQPL---TLLKDIRSVLEPTRGRVILALVFHPYVENVGGKWEKPSEILE-QNWEEQVNSLPEVFRKAGFVIEAFTRLP........... 239
16 -25.300PF01170.18; Q9RTT7_DEIRA/193-364; Putative RNA methylase family UPF0020 topsan  ali follow..  16  12....................................................................................................................LNATIAYAMHKLAGQRDEDRIFNPMSGSGTLLIERALLGP--YAALVGVDIDPVAVACARTNLRAAGKE--VEVAQVDALH---TGLPSRSFDLVISDLPWGDAIGETLYPAFLKEMHRLTSRRGRLCLLTHELRLFERVMRE.................................................. 152
17 -25.000PF07091.11; KRM_FRACC/28-281; Ribosomal RNA methyltransferase (FmrO)  ali follow..  10  1..........................RSRRYGAVAPETVRRLAERALVASRGDEPEAVKRTKRSLHEIYGRAPGYPGLLRDIGAAVGGGDPD--AVAAAVSRAMRVHASTRERLPYLREFYAAVFGAV---PTPAVVQDLACGLNPLAFGSMGLPA--QTTYLASDIDSQQMEFLDRALDLLEVE--HRVEVVDLVS---GAVPAQHADVTLVLKTLPLLERQR--AGAGWELVDALRSPFVVVSFP--------------TRSLGQRSKGMFQTYSAAFEAQAAERGWTFDQAEIANELIYI...... 254
18 -24.400PF03059.16; A3DUI9_MALBX/3-277; Nicotianamine synthase protein  ali follow..  10  3GDALVQRVCELYEKISSLESLKPSQDVDMLFTQLVLTCIPPSPIDVSKLCQG--------VQEIRSNLIRLCGEAEGLLENHFSTILGSYEHPLDHLDIFPYYSNYLKLSKLEFNILSQ---------HFTRMPIKIAFVGSGPLPLTSIVLASNHLTKTSFDNYDINASANSKALGLVSSDPLSKRMVFHTTDIMD---VTTALKDYEIVFLAALVGMDKMEK--LKIIDHLAKYMAPGATLML-----------------------------RSAHGARAFLYPVGFEVLSVFHPTDEVISIVIARK 270
19 -23.100PF05175.14; A6WWW0_OCHA4/169-336; Methyltransferase small domain  ali follow..  20  17.........................................................................................................................SALLVPHMEKIFFGNVADLGAGWGYLAAQCLKFAD-RIKSIDLYEADYEALEAARGNLERLGASVPISFNWFDVTS----EKMAGIYDTVIMNPPFHE-TDVSLGQAFIAAAASRLKPGGRLLMVANRQLPYETTLKGLF----------------KNVTLLEEANGFK................... 166
20 -22.900PF07021.12; Q89UL6_BRADU/24-217; Methionine biosynthesis protein MetW  ali follow..  15  1..............................................................................................................RADHLLVAEMVK----------PGSKVLDVGCGDG----DLLQLLETRGIDGRGIELSREGVNRCVAKG--------LAVVQGDA-DTDLVNYPDDAFDYVILSQTLQATRQPRVV------LENLLRIGRRAIVSFPNFGFWKMRLQLLIGGHMPRTENNIHFCTIKDFVELCDEINVKMERSV.............. 165
21 -22.800PF07942.12; Q6L536_ORYSJ/216-485; N2227-like protein  ali follow..  11  6...................................................................................NVPPIDVDKVRCIIRNIVRD--AQEGQKERDECYKPILEELNRLFRSKERPPSCLVPGAGLGRLALEISTLGF----VSQGNEFSYYMMICSSFILNSSGITEGFSMCAGDFVEVYNEESQESSWDAVVTCFFLDTAHN---IVEYIEIISKVLKDGGVWINLG---------LLYHFADSYGPDDDMSIELSLEDVKRVAYHYGFVMEVEKMIDTTYTAFWTMRK 268
22 -22.700PF03269.14; A0A2H2IKF9_CAEJA/181-356; Caenorhabditis protein of unknown function, DUF268 topsan  ali follow..  10  1.....................................................................................................................................GQSGVVIGSMQPWVEVSALVN---GAKKILTVEYNKLTIQEEFRDRMSSILP---------VDFAKGWANYADTFNFAASFSSIEHSGDPIGDIREILKIKCVLKKGGLLFLGSIVYNAHRIYGPIRLAMMFYGFEWIATFSGRGEDPIDLNSATLHARQMFEHAQSTLVL---RK 175
23 -22.300PF13489.6; C5G7B3_AJEDR/109-340; Methyltransferase domain  ali follow..  13  1................................................................................................YDAEVEMAERIMRVGKKREELVRRAR-------------NVLEVACGTGRNM-KKGKAEIQGCRSVTFVDQSPQMVEIAREKFEKMYKDSKAISLQTPE---ICAQQQSGKFDTVIQTMGLCSLPDPV---SYLTHLGTLVEPRGEILLLEHGRSHY-RWLNKLLDDLAAAHADRHGCWWNRDIGEIVRQSGLEIVE................ 231
24 -22.200PF00891.18; ASMT_BOVIN/117-327; O-methyltransferase domain  ali follow..  19  2...........................................................................RHLAEAVREGRNQYLKAFGELFSAIYRSEDERLQFMQGLQDVWRLEGATVLAAFDLSPFPLICDLGGGSGALAKACVSLYP--GCRAIVFDI-PGVVQIAKRHFSA-SEDERISFHEGDFFK-----DALPEADLYILARVLHDWTDAK-CSHLLQRVYRACRTGGGILVIELLDTDGRGPLTTLLYSLNMLVQTEGRERTPAEYRALLGPAGFR................... 211
25 -22.000PF13679.6; Q12FV8_POLSJ/56-202; Methyltransferase domain  ali follow..  17  4...............................................................................................................KQVYHLYQFIEPLLNEVSANNPAPTLADHGAGKSYLGFILYDLFFNDAGHIYGIETRTELVDKSRALAARLGFER-MSFLNLSVQQATASADLPERIDIVTALHACDTATD--------DAIAFGLAKQARHMVL............................................................... 136
26 -21.800PF01269.17; A8M8R8_CALMQ/9-236; Fibrillarin  ali follow..  13  61..........................................................................................................................MNKLEAMPISEGSKVLYLGAASGTTVSHVSDIVGLNG-LIYGVEFSPRVFREFMQNIIDQGRLN-VIPILADARYPEQYISLVKGVDVA-----YIDVAQPFQAKILADNADVYLVKGGYIILVIKAMSIDVTKEPSE---------------TFKREIDTIKERGFDIINMVH-----HALVVGKR 227
27 -21.200PF09243.10; Q2YRR8_BRUA2/49-320; Mitochondrial small ribosomal subunit Rsm22  ali follow..  14  19......................................................................................................................RASLDSAAESCPEFAPQSMLDVGAGPGTALWAAKQCWPELQ-SATMIEASPAIRAVGSDLARHSGLTM----LDWRAGDVVRERLEFPYADLVTIAYVLDELAPDEREKLIERLW---ASARQMFVIVEPGTPAGWRRILDA................................................. 152
28 -20.300PF08242.12; MLCA_PENCI/1437-1538; Methyltransferase domain  ali follow..  20  1.........................................................................................................................................LEIGLGTGIATKRVLASPQLGFNSYTCTDISADVIGKAREQLSEF--DGLMQFEALDI-SPAEQGFKPHSYDLIIASDVLHASSN---FEEKLAHIRSLLKPGGHL.................................................................. 102
29 -20.200PF02353.20; CMAS2_MYCTU/12-298; Mycolic acid cyclopropane synthetase  ali follow..  10  7...............................................................................EAVRSHYDKSNEFFKLWLDSMTYSCAYFERPDMTLEEAQYAKRKLALDKLNLEPGMTLLDIGCGWGSTMRHAVAEY---DVNVIGLTLSENQYAHDKAMFDEVDSPRRKEVRIQGWEEF------DEPVDRIVSLGAFEHFADFERYDTFFKKFYNLTPDDGRMLLHTITIPDKQELGLTSPMSLLRFIKFILTEPRISQVDYYSSNAGWKVERYH.............. 230
30 -20.000PF05185.16; ANM5_ORYSJ/308-478; PRMT5 arginine-N-methyltransferase  ali follow..  20  44.................................................................................................................QRAIAKALVDRVSDDDVSTTKTVLMVVGAGRGPLVRASLQAAEETKLKVYAVEKNPNAVITLHSLIKLEGWESLVTIISSDMRCWE----APEKADILVSE-LLGSFGDNELSPECLDGAQRFLKPDGISI................................................................. 171
31 -17.700PF04672.12; Q9WX26_STRCO/10-300; S-adenosyl methyltransferase  ali follow..  12  11........................................................................................SKAHPARVYDVFLGGKDHYPADLAAAAAGLAALRRAVTALAREDGIRQFLDIGTGTAENVHQIAQRIA-PESRVVYVDDDPVVLAHARALLTSGP-EGRTDYIDADLKSPAQLEQAAATLDFLCLVAILHFVEDEE-AYPIVRELMDALPAGSRLVLSHLTEDLNPENIRAVQRTYTERGF-TFVLRSRKDVERFFTEAGLELAE------GVVPV..... 239
32 -17.700PF03141.16; PMTB_ARATH/186-689; Putative S-adenosyl-L-methionine-dependent methyltransferase  ali follow..  15  102.....................................................................................................................LDQMSKMVSDITFGKHIRVAMDVGCGVASFGAYLLSR-DVMTMSVAPKDVHENQIQFALER----GVPAMAA-----AFATRRLLYPSQAFDLIHCSRCRINWTRDD--GILLLEINRMLRAGGYFAWAA.............................................................. 219
33 -17.300PF03686.13; Y73A_ARCFU/3-126; Uncharacterised protein family (UPF0146 topsan)  ali follow..  10  2..........................................................................................................................LQIADYIAENYRGKVVEVGIGRFTAVAELLAR---RGFEVFATDVVERRAP------------EGCRFYVDDVTKPN--LKIYEGASLIYSLRPPPELFSA------IVEVSRKV--GADCLIKPLYGD.......................................................... 105
34 -17.200PF06325.13; PRMA_STRA5/3-308; Ribosomal protein L11 methyltransferase (PrmA)  ali follow..  11  136.................................................................................................GEKIIKMDPGMAFGTGTHPTTKMSLFALEQVLRGGE--TVIDVGTGSG---VLSIASSLLGAKDIYAYDLDDVAVRVAQENIDMNPGTENIHVAAGDLLKG-----VQQEVDVIVAN--------ADILIHLTDDAYRLVKDEGYLIMSG------------------------IISEKWDMVRESAEKAGFFLETHMVQ--GEWNACVFKK 305
35 -17.000PF01596.17; A9PCU8_POPTR/22-233; O-methyltransferase  ali follow..  18  37..........................................................................................................................RFLSMLLKLMNAKRTLEVGVFTGYSLLSTALALPEDG-QVTAIDKDREAYEIGLPFIQKAGVEEKINFIQSEATPILN-NDKQPEFDFAFV-------ADKSSYKHYHEQLLKLVKIGGIIAYDNT............................................................. 158
36 -16.800PF05724.11; TPMT_VIBCH/2-217; Thiopurine S-methyltransferase (TPMT)  ali follow..  15  22....................................................................................................................VNPLLIRFWSDL-APKRSEKVLVPLCGKSEDLIWLAN----QHDSVQGVELSQIAVRSFFAEHFYTPTFDELTLFTGDFFTAPV-----ESVDLVYDRAALVALPEEMR-AEYAQRVLQLLKPGGRILLVSMDYVQ----------TELSGPPFSV---PEAEIRTLFMGC...................... 180
37 -16.500PF01861.16; Q8U1U4_PYRFU/105-348; Branched-chain polyamine synthase A C-terminal domain  ali follow..  4..............................................................................................EQFREIVKDRPEPLHEFDQAYVTPETTVARVILMHTRGENKDIFVLGDDDL---TSIALMLSGLPKRIAVLDIDERLTKFIEKAANEIGYED-IEIFTFDLRKPLP-DYALHKFDTFITD-------TLEAIRAFVGRGIATLKGPRCAGYFGITRRESSL-------------------KWREIQKLLLNEFNVVITDI............... 178
38 -16.300PF11599.8; A0A0J1DJF7_9FIRM/1-235; RRNA methyltransferase AviRa  ali follow..  10  1..............................................................................MKYRFEIEAKNYEDFAS---------GRVLYNRKGATAFPVRLGSEIIQRCRGKVPLTIYDPCCGGAYLLTTIALLHGREFSKLYASDVDGEILELAKANLALLTPAGEIHCMEIDVLRPGAGKIAPQSIDIVITDVPYGSIASTDPIGVMLSNLRPAVRDQGVVALV............................................................... 212
39 -15.900PF01739.18; CHER1_PSEAE/72-269; CheR methyltransferase, SAM binding domain  ali follow..  13  13..................................................................................................................EVLKQRVLPELIK-ANGGQRLRIWSAACSSGQEPYSLSLGQLKAGVQIVATDLSGSMLTAAKAGE-KPAIRSRVEFRALNLLD------SLGKFDMVFCRNVLIYF-SAEVKRDILLRIHGTLKPGGYLFLGASEA........................................................... 181
40 -15.500PF02390.17; TRMB_DROME/71-251; Putative methyltransferase  ali follow..  16  1....................................................................................................................................QQVSFADIGCGYGGFLVTLGEMFP--EKLSIGMEIRVKVSDYVVDRIAALRRRQNIACLRTNAMKYLPNYFVKGQLEKMFF-----LYPDP-INQALLSEYAYILRKGGLLYTMT.............................................................. 125
41 -15.500PF10672.9; Q87QG2_VIBPA/25-310; S-adenosylmethionine-dependent methyltransferase  ali follow..  17  112.........................................................................................................................RYGRDWVRENAKHKNVLNLFAYTCGFSVAAIA---GGADKVVNVDMAKASLSKGRENHKLNGHNNQVSFMGHDIFKSWGKIKKSGQYDLIIISFQKGSFALTKDYKKILRRLPDLLAEGGQVMACVNSPSVTSDFLIESMKEEAPELTFRERLDNPPEFMDVDSEAALKVLLFS.............. 286
42 -15.500PF07279.11; Q9LZY5_ARATH/1-218; Protein of unknown function (DUF1442 topsan)  ali follow..  10  16...........................................................................................................HTVRSCKSYRDSSVAEFLSATAAGWNTRLIVETWSDPIATSVGLAVAAIHTCGRHVCIVPDEESRSEYEAVMRGAVTSDSTEVMVLDSAE--DVVERISGVDFMVVDS------KRHEFVNALGLA-KTSKMGAVLVCKNA............................................................. 149
43 -15.400PF08704.10; Q6DFS3_XENTR/64-300; tRNA methyltransferase complex GCD14 subunit  ali follow..  11  14..........................................................................................................TLNLPHRTQILYSTDISLITMMLELKPGSVVCESGTGSGSLSHAIIRTVAPTG-HLYTVEFHQQRAEKAIEEFRQHKVDHLVTVKNQDVCKHGFG--VTGIADAVFL--------DIPSPWEAIGHAKSAMKSEGGRICS-----------------------FSPCIEQVQRTCLALEEHGFTEINT............... 167
44 -15.400PF09445.10; Q6CRW0_KLULA/100-266; RNA cap guanine-N2 methyltransferase  ali follow..  10  4........................................................................................................................................IVDVFCGGGGNTIQFARLFE----KVYGIDSNIDHLYCAYKNAECYNSAVKLKLIYGDWEESLKVKNLGKTPDCIFAS............................................................................................... 80
45 -15.300PF10294.9; Q6C9L2_YARLI/34-201; Lysine methyltransferase  ali follow..  10  40....................................................................................................................................SYPRVLEIGSGTG--LAIALSESAPPNLKVWVTDQ-ENMIPLMNQNIELNNLQDKVVAEVLDWGEELPEFLEGQPVDLVLAA---DCVYLESAFPLLEKTLIDLSNKDTKILMSYKKRRKADSRFFKSVKKH............................................. 168
46 -14.600PF01564.17; SPEE_SCHPO/71-256; Spermine/spermidine synthase domain  ali follow..  15  13...............................................................................................................................LNSHPNPKKVLVIGGGDGGVLREVVKHECVE--EAILCDIDEDVIKVSKQYLPEMS-HPKVKVHIGDGFKF--LQDYQNTFDVIITDSSDPDGPAEALFQKYFQLLSDALRGGGVITTQAECMWIHLGVISNVL----------------TAVKTVFPNVRYAYTTIPTYPSGSIGFVVASK 178
47 -14.100PF01135.19; PIMT_CAEEL/8-220; Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT)  ali follow..  15  56...................................................................................................................HMHAAALDYLQNHLVAGA--KALDVGSGSG-YLTVCMAMMVGRNGTVVGIEHMPQLVELSEKNIRKHHSEGNVIIIEGDGRQ------EKAPYNAIHVGAASKGVPKA---------LTDQLAEGGRMMI................................................................ 174
48 -14.000PF01189.17; RSMB_ECOLI/239-427; 16S rRNA methyltransferase RsmB/F  ali follow..  18  2..............................................................................................................................TWLAPQNGEHILDLCAAPGGKTTHILEVAP--EAQVVAVDIDEQRLSRVYDNLKRLGMKATV--KQGDGRYPSQW-CGEQQFDRILLTGVIRRHPDAQLQSEILDAIWPHLKTGGTLVYATCSVLPE........................................................ 142
49 -13.900PF04816.12; Q9A050_STRP1/22-222; tRNA (adenine(22)-N(1))-methyltransferase  ali follow..  12  1........................................................................................................................................LLDVGSDHAYLPIFLVETNQIS--AAIAGEVVRGPYESALKNVTQSGLAEHIQVRLANGLAAFE---EADDVTAITICGM-----GGRLIADILEAGKEKLQGIERLVLQPNN--------------------------REDDLRAWLSVNAFKAETIMAENDKYYEIIVAEH 139
50 -13.500PF12847.7; A9KI22_LACP7/3-153; Methyltransferase domain  ali follow..  13  1........................................................................................................................LSKRLRMVAD-TKGNVVADVGCDHAYISIYLVEGKIAP--KTIALDVNEGPLLRAQENIISYGMENLITTRLSDGLH----MLKPNEVDSIVIAGM-----GGALMIRILEEGSECVAAAKELILQPQS--------------------------EIWRVREYLHNLNFEKEDMCIDEGKYYTVL.... 151
51 -13.200PF08123.13; DOT1_DEBHA/959-1163; Histone methylation protein DOT1  ali follow..  11  32..........................................................................................................................SEVLTKVNLQPQHKFYDLGSGVGNTTFQAALEFGVH--LSGGCEIMEHASKLTELQTMLLNFALSQSFVENDIVRQA------IECDVLLVNNYL-----DVNLNTAVGKMLYGLKPGTKIISLR.............................................................. 159
52 -13.100PF04989.12; A8ZT86_DESOH/39-259; Cephalosporin hydroxylase  ali follow..  12  23...........................................................................................................................AMQELIWKVKPDLILETGIAHGGSLIFSASMLALLEYRVLGIDIDIR--EHNRAAIEAHPMAGRIQMIQGSSVDAEVIQKVEFSRILVCLDSMHTH----DHVLAELEAYAPLVSPGSYCMVFDTIVE.......................................................... 166
53 -13.000PF10017.9; L0GU32_9GAMM/37-337; Histidine-specific methyltransferase, SAM-dependent  ali follow..  15  20................................................................................LFYDER-------GSQLFDAITELSEYYPTRTEIGILRAHGAEMAERL---GRGSVLIELGSGSSLKIQTLLAAL--EPRVYIPVDISREHLLKSARALATRFEDVRIRATCADYSRFELPLDPDWRDLAAFFPGSSIGNFEPTEARRLLTRVANLIGDGGRLLIGVDLPKDPLILEAAYDDAQGVTAVFNRNL-DLTDFQRLAREAGFTTEQVWTDPEQLFSVHCLRR 301
54 -12.200PF02005.16; TRM1_CAEEL/9-442; N2,N2-dimethylguanosine tRNA methyltransferase  ali follow..  12  28...............................................................................PVFYNPVQEFNRDLT-VLRQFSADHQKWAEEQKQLKTEEEPPKKKNKLAINEDGKIRILDALSASGLRALRFSKEVPNVG-FIMANDFSDNAVASIQENVKLNGVEDIVEAHFGDAVMMMEHRGIDKRFHAV--------LDPYGTASTFLDSAVQCVADRGILMVTCTDMAVLCGNTPEACYNKYDAVTTRMKCCHEVGLRILLRAIDSAANRYTRYIEPLVSISV... 248
55 -12.200PF06962.12; YTQB_BACSU/48-187; Putative rRNA methylase  ali follow..  1.................................................................................................................................................................VYAFDIQESAVANTKERLGDMYQ-ARTTLFHKSHDKIAESLPPETHGKVAAAVFNLGYLPGGSSTIKAIEQLLSIMKDEGLIVLVVYHGHP......................................................... 98
56 -11.800PF02527.15; RSMG_HAEIN/20-200; rRNA small subunit methyltransferase G  ali follow..  15  23............................................................................................................SVRDPQEMLVKHILDSLV-VSPYLQGDRFIDVGTGPGLPGLPL--AIINPSKQFVLLDSLGKRISFIRNAIRELRLTN-VTPVLSRVEEYQP----EDKFDGVLSRAF-------ASLKDMTDWCHHLPKENGYFYA................................................................ 144
57 -11.700PF03602.15; RSMD_ECOLI/12-188; Conserved hypothetical protein 95  ali follow..  14  4............................................................................................IGGQWRGRKLPVPDSPGLRPTTDRVRETLFNWLAPVI---VDAQCLDCFAGSGALGLEALSR---YAAGATLIEMDRAVSQQLIKNLATLKA-GNARVVNSNAMSF--LAQKGTPHNIVFVDPPF----RRGLLEETINLLEDWLADEALIYV................................................................ 145
58 -11.700PF01728.19; Q7QB53_ANOGA/52-237; FtsJ-like methyltransferase  ali follow..  11  2..............................................................................................................RCRSAF---KLLEIDSKYGLVKPGHTVIDCGASPGSWTQIAVKQSNADGGMVVGVDLLQ-------YPIEHAILFGNSDFLRKETQDKIRASLGERRVDCVLSDMALDQENITTLCYAVLRFAILMSTPNASLLMKVWDNGDVPKLEKSILEYYKTVKRVKPRASRDDSAENFILARGF.................... 186
59 -10.800PF05206.14; TRM13_KLULA/161-430; Methyltransferase TRM13  ali follow..  17  1..............................................................................................................RQQSSLIQHLKESKLLESCAVNKTLEYIELGCGRAEFSRYVNIATNLDAPSFTLIDRASQRLRFDNKFSSDIGTEVQIRREKIDIKDLRDAVLHDASQYVAISKHLCGVATD-LSLRCLLNSDKCKANLRGILIA................................................................ 152
60 -10.800PF00107.26; ADH_SULSO/182-311; Zinc-binding dehydrogenase  ali follow..  15  1..............................................................................................................................................GLGTMAVQIAKAVS--GATIIGVDVREEAVEAAK----RAGADYVINASMQDPLAEIRRITESKGVDAVI---------DLNNSEKTLSVYPKALAKQGKYVMVGLFGADLHYHAPLITLSEIQFVG--SLVGNQSDFLGIMR........................ 126
61 -10.600PF05971.12; RLMF_ECOLI/3-296; RNA methyltransferase  ali follow..  10  78.............................................................................................................VPGRADYIHHLADLLAEASGTIPANASILDIGVG-ANCIYPLIG-VHEYGWRFTGSETSSQALSSAQAIISSNPGLNRAIRLRRQKESFNGIIHKNEQYDATLCN----FHDSAAAARAGSER-QELWCEGGEVTFIKKMIEESKGFAKQV----MWFTSLVSRGENLPPLYRALTDVGAVKVVKKEMAQG......... 281
62 -10.500PF10354.9; M7SVX6_EUTLA/61-229; Domain of unknown function (DUF2431 topsan)  ali follow..  13  1.........................................................................................................................................LLVGDGDLSFSASLVEHHYCADVTATVLEKNLEELPQAPENIAKIEAEDSKVLFNVDATTMRPFKDGVGIMDRIIFN---QVRYNQELLVAFFKQAMFSLAPGGSIVVTLFEGEP--------------YTLW--------NIRDLARHSGLQVERSFRFQASAYPGYHHAR 169
63 -10.200PF04445.13; M4RGN1_BIBTR/17-246; Putative SAM-dependent methyltransferase  ali follow..  12  67................................................................................................................................IKGDYLPTVIDATAGLGRDAFVLACI----GCKVTLIERNPIVSALLEDGLKRAYQDERMVLAGVSAINE--LNIEQDFADVVYLDPMYPHKQKSALVKKEMRVFQHLVGAD..................................................................... 180
64 -9.950PF02636.17; Q31EL6_HYDCU/79-324; Putative S-adenosyl-L-methionine-dependent methyltransferase  ali follow..  2........................................................................................................................LARQAAQVLETLETPNVIEFGAGKGTMAKDILLELDALEEQYYIVELSADLRARQQETLQALPETLFNKVVWLDQLPKDPLQ------AVVLANEVLDAMP-NLNIHPWLQSIADFLSQGAVLLI-------DYGYNRKEYYQPSRHMGTLRCHYQHRAHGDPFFFPGLQDITAHVDFTSV........ 231
65 -9.850PF06859.12; E5S6E5_TRISP/398-506; Bicoid-interacting protein 3 (Bin3)  ali follow..  12  1...............................................................................................................................................................................................................YDTVMAFSITKWIHGDEGIKRFFKRVYLNLKPGGRLLL---EPQAFSSYAKRRGLCQEIYDNYKSITLMPDEFPKYLAEVGFASYR................ 88
66 -9.850PF02475.16; O28306_ARCFU/90-284; Met-10+ like-protein  ali follow..  11  77...............................................................................................................AKVMFSLGNQAERMRIARLVEDGEVVVDMFAGIGYFSIPIAVH--SKARRIYSIEINPESYKLLLENIKLNDVGNIVPI-LGDSQFV----TPEGVADRVVM--------GHIYCHDYLHTAIRALKERGVV.................................................................. 193
67 -9.520PF06460.12; R1AB_CVMA5/6879-7175; Coronavirus NSP16  ali follow..  10  1.....................................................................AADWKPGYVMPVLYKYLESPLER--VNLWNYGKPITLPTGCMMNVAKYTQLCQYLSTTTLAVPANMRVLHLGAGSDAPGSAVLRQWLPAGSILVDNDVNPFVSDSVASYYGNC-----------------ITLPFDCQWDLIIS---EYNVSKDGFFTYLCHLIRDKLALGGSVAIKITEFSWNAEL---------------------YSLMGKFAFWTIFCTNVNASSSEGFLIGINWL 211
68 -9.520PF08468.11; E0SLN4_DICD3/8-162; Methyltransferase small domain N-terminal  ali follow..  1.........................................................................................................................SEVILRHSDEFVSRRVLFAGDLQDTLPANFDAA------AVTVHTTQYHHWQQLQPVLGD-----------NVHFSLLAQAETVAGCDTLIYY------KSKQEAQFQLSNLLSLLPVGCDIFVVGENRSGVRSAEGIL................................................. 118
69 -9.330PF12692.7; Q2K041_RHIEC/1-158; S-adenosyl-L-methionine methyltransferase  ali follow..  13  9...............................................................................................................RRLTAQRDILNAITALVEDIEGP--VLEFGLGNGRTYDHLREKFPGR--RIIAFD--------WEVRSYSASTPEPQDMVTGNIRDSGQAFLGIGAALAHADIGTGHDEIDAVTLTWLPQLMAGVLAPNGIAVSGLPLEHP......................................................... 137
70 -9.110PF05958.11; TRMA_SHEON/10-365; tRNA (Uracil-5-)-methyltransferase  ali follow..  12  185....................................................................................................................VAIKMLEWAIDVTQNSQG-DLLELYCGNGNFSIALAQNFN----RVLATELAKPSVDAAQYNIEINGIDN-LQIIRMSAEELEGIDLDSYLCNTIFV--------DPPRAGIDPATLDLVQGYERILYIS----NPDT------------------LKDNLQQLYKTHKVTRFALFDQFPYTDHMETGVLLER 355

FFAS is supported by the NIH grant R01-GM087218-01
1 3 9 2 2 3   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Slabinski L, Jaroszewski L, Rodrigues AP, Rychlewski L, Wilson IA, Lesley SA, Godzik A. The challenge of protein structure determination--lessons from structuralgenomics. Protein Sci. 2007 Nov;16(11):2472-82.