current user: public

If you have questions about the server, please let us know.

Query: PF12348.8; B8M2E9_TALSN/325-551; CLASP N terminal, from PfamA32U

Results of FFAS03 search in PfamA32U
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .
# Score Template Links and tools%idFirst IDDMLRNMLPHFEGRETEHNWIPREKSVETLRRLVRGNAPQTYSQHFIAGIKSLLDGILKVVNSLRTTLSTTGCLLIQEIAKVCGPGIDNMVEILLQNMIKLCAGMKKISAQNANATVDAIISNVTYVPRILQHLSFACQDKNVQPRLFAAGWLKTLLNKQARHKSSIEHGGGLDLVEKCIKKCLGDPNPGVRESMRGTFWTFYKIWPDRAEEIISTLDAKSKTLLELast
1 -68.200PF12348.8; B8M2E9_TALSN/325-551; CLASP N terminal  ali  100  1IDDMLRNMLPHFEGRETEHNWIPREKSVETLRRLVRGNAPQTYSQHFIAGIKSLLDGILKVVNSLRTTLSTTGCLLIQEIAKVCGPGIDNMVEILLQNMIKLCAGMKKISAQNANATVDAIISNVTYVPRILQHLSFACQDKNVQPRLFAAGWLKTLLNKQARHKSSIEHGGGLDLVEKCIKKCLGDPNPGVRESMRGTFWTFYKIWPDRAEEIISTLDAKSKTLLE 227
2 -17.100PF12755.7; C4QYN7_KOMPG/59-156; Vacuolar 14 Fab1-binding region  ali follow..  14  1.....................NSRNGGLIGLAATAIA----LGQHEVPKYLEKIIHPVLACFGDQDARVRYYACESLYNISKVAKGEILLYFNEIFDNLCKLTADSEVSVKKGADLLDRLI.......................................................................................................... 96
3 -12.400PF04118.14; C4QZW5_KOMPG/11-303; Dopey, N-terminal  ali follow..  15  4.KKYLSNVQKTIASFASVVEWADYISFLGRLQKALQSNPIMLGQEKLGQDISIWLPGLLPLMNYASITVRPQLIDLFSSFVAKIAPALHPVLRALLLGIWPALDDPTSECFESAFQLVDNLKKAVDDNEHFWKCLFLSI--NSGDRKLGALFQNENILALLSSEARECVNPE-PGLLITAMCKGLQDESIFVQ---RGFFDLLTSRLELRSDVIQKLASQSDKEKL. 265
4 -12.100PF13646.6; C3YB05_BRAFL/324-412; HEAT repeats  ali follow..  21  1...............................................................................................VSSLKKLLVDEDPNIRAVASIALGKT----TCTPDIVEALVNLLKDEDRLVRESTCVSLGYL--------------QAQDAVPHVINAWRNDPISHVREAAQAAL........................... 88
5 -11.800PF05918.11; D7TJH2_VITVI/11-547; Apoptosis inhibitory protein 5 (API5)  ali follow..  1....IEKLYEYGERLNEAKDKSQNVEDYRGIIAAAKGSIKARFFKFFPDLSDAAVDSHLDLCEEEELGVRVQAIRGLPLFCKD-----PEYVSKIVDILAQLLTAEENVERDAVHKALLSLLRKASLTGLFKHIMTVDDPSTDENLREKVLNFIRDKVFPLKAELLKPQEQME-RHITNLIKKSLEDVTGAEFKMFMDFLRSLTLFGEKAPPERVQELIEIIEGQAD 230
6 -11.500PF05004.13; T1J854_STRMM/21-332; Interferon-related developmental regulator (IFRD)  ali follow..  43LIDKLKDAIDGATQKNAKG----RQTCLESIQNVLSR---KYLPDVIDTRRETITECIKSSLKRGKVDEQSAAAILAVLTCIQLGSSSDSMFAELCPVLTTSLNDKSLKTRGTCATALALLAGTIISLMSTFEALVPNHALEVTALHSSALAAWSLLLTVVSINDV----SSMAERHVMRLSELLESSDVELRIVAGETIALLYEI--DDLSFKLKQLATDSHKYRA 293
7 -11.000PF10508.9; A7SP09_NEMVE/2-505; Proteasome non-ATPase 26S subunit  ali follow..  5......................................................CKELVENISNASGDEIVAFLRDLSVLISSSPNIRDLASLIPSERLFNCLRTTNTDQITYCKNILKNILKFEKPDAPAHDAVIEGLNHPTEDVRELCLIELERCSGTVNGVLALMDKED----LLSYIARGMADEHLKNAQIASNVFTNLAKHEAGLKVLFDSHLQSEFNALLK 176
8 -10.800PF12717.7; G8Y240_PICSO/105-271; non-SMC mitotic condensation complex subunit 1  ali follow..  10  15VARMVDFIEIPLKRTLSDDNPYVRKTAAICVAKLFDLSPKACVEFGFLDQLRGL-------IKDSNPMVVANALNSLFEIKDMNVDSSLVVLEFLIKTLLMCLNECTEWGRITILDTLTKYESSSEEASHIIDRATPQLQHANPSVVLSSIKVI......................................................................... 165
9 -9.810PF12460.8; H6C711_EXODN/528-954; RNAPII transcription regulator C-terminal  ali follow..  186KTQIPQTITQLILFASKSTSRGITQSCLLQIALYVNKHVETADLDFVDNLLSNTLSNLQDE-PMDGSPPRDFNIRAAFTLIKALILRLSPKTDQYLTSLVGLLDEGDDVLSRKNFAQIRLLAPQRVFQMLTPLISEKFRASQSPTEKENYLIALSGILASVPSNIVM----PELPTLLPLLLQSLDVTDQMVKTATLETLAVVISNNPAALE-ESGHIPALVKRLIA 426
10 -9.780PF17741.1; A0A151PBS4_ALLMI/1-268; Family of unknown function (DUF5578 topsan)  ali follow..  63.......TAWLRLSYMNGTCLDQLLKAIGIFLSAASGHRYLIE----VGGVLTLLEILGL--SQLKEEDKKESIKLLQLVANAGRKYKELICESGVRSIAEFMASSKSEAQRQVQILLDSLGHNPKYQNQVYKGLIALLPCTSPHAQQLSLQTLRVVQAIVGKSH---------PSIVEAVLGVLRSMELEVQYEAIQLIKDLTSYDVRPLRGLVALLKP....... 268
11 -9.520PF08167.12; B8ND91_ASPFN/7-219; rRNA processing/ribosome biogenesis  ali follow..  10  51................................................VQVHKLMTRLASLLQDRSPEGRWTAVVLVKAVVEAGQWEILRGCEPLVRGLIAILAKPDPSTKKMSIITLTRIFHLTYQYPTL--------------VREITTPSLPSFVTSA----------NLISVKPSSEPTRKLKPHSPFLETVLNALGELIARHPTIFRPFSAQIHSILQAIIG 207
12 -9.460PF12783.7; S8B8B3_DACHA/521-691; Guanine nucleotide exchange factor in Golgi transport N-terminal  ali follow..  10  34.....................RSKLLSLHLILTLLKQHALVFTNTQFVQAIKQLCLSLSRNAASAVPWVFEICSEIFWLVVRDMRSTLKKELEVFMKEIYLAILENKNSSLQQKHSILGLFERISSDPKALVEIYLN.......................................................................................... 163
13 -9.410PF12231.8; Q5BCS0_EMENI/131-504; Rap1-interacting factor 1 N terminal  ali follow..  87KLFLIEHSVVCLESENLPKSVVTHYLTVLSTQKFPARIITAARTTRILGMLHSITDRVKG------NSVISQRLMIYERLFDVAKPTFLALSTLWMDHLISGLLHQIKNVRLNALELGFNVYMASGSNSTLSKTLRDIFDRPNPETGEHVPQIWGVITLLLRSKRFNIDQWQHFKEWVLVLQKCFNCNDPEIKSKAIGNWNRF........................ 303
14 -9.250PF00790.19; GGA1_YEAST/16-161; VHS domain  ali follow..  13  9.....RKIQRACRSTLPEPDLGLNLDVADYINSKQGATP------------REAVLAIEKLVNNGDTQAAVFALSLLDVLVKNCGYSIHLQIKEFLNDLVKRFPEQPPLRYSKVQQMILEAIEE....................................................................................................... 117
15 -9.240PF04826.13; ARMX3_MOUSE/110-363; Armadillo-like  ali follow..  14..................................................LQKVLCLVE---MSEKPYILEAALIALGNNAAYAFNRDIIRDLGGLPIVAKILNTRDPIVKEKALIVLNNLSVNAENQRRLKVCDDTVTSRLNSSVQLAGLRLLTNM-------TVTNEYQHILANSISDFFRLFSAGNEETKLQVLKLLLNLAENPAMTRELLRAQVPSSLGSLFN 185

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 1 4 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Friedberg I, Nika K, Tautz L, Saito K, Cerignoli F, Friedberg I, Godzik A, Mustelin T. Identification and characterization of DUSP27, a novel dual-specific protein phosphatase. FEBS Lett. 2007 May 29;581(13):2527-33. Epub 2007 Apr 30.