current user: public

If you have questions about the server, please let us know.

Query: PF12371.8; A9UVP6_MONBE/19-102; Transmembrane protein 131-like, from PfamA32U

Results of FFAS03 search in PfamA32U
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80
# Score Template Links and tools%idFirst PVLVPPFLRFPQQELCKVAERVVTVVNGNPRADLHLYSISSNSNDFHSSWFEHAVVAPGDNTTFTIAFMSETLGPVEANITLLTLast
1 -52.200PF12371.8; A9UVP6_MONBE/19-102; Transmembrane protein 131-like  ali  100  1PVLVPPFLRFPQQELCKVAERVVTVVNGNPRADLHLYSISSNSNDFHSSWFEHAVVAPGDNTTFTIAFMSETLGPVEANITLLT 84
2 -32.400PF15780.5; G3VKZ4_SARHA/34-131; Abnormal spindle-like microcephaly-assoc`d, ASPM-SPD-2-Hydin  ali follow..  17  7HFSRPPFLCFGDVRVGVSRTLPLVLDNPNEEGEVSVARLPAADKGFSISP-QSCALQSKERISLSITWTPAKEGRVREMITFLV 90
3 -25.200PF14874.6; Q4DUQ4_TRYCC/1589-1690; Flagellar-associated PapD-like  ali follow..  14  2PTLMPSVLSFGRVIRGNRYALPVVFTNTSTVPCRYRVTLPTECKDILRVHYPRHFLAPGLTVMAQVEISGTQPGAMSFSLNVTH 88
4 -19.400PF07610.11; F0NZP4_WEEVC/51-148; Protein of unknown function (DUF1573 topsan)  ali follow..  13  2.VLSESNFNYGDVKMNESKDHYFVITNEG-KSPLVIKDARATCG--TVPEWPKEPIPAGGKDSIKVQFTAGTLGNTQKKVSLTT 83
5 -15.700PF00927.22; EPB42_HUMAN/588-686; Transglutaminase family, C-terminal ig like domain  ali follow..  13  1PHLAIKM---EKAEQYQPLTASVSLQNSLDAPMEDCVSILGRGLIHRERSYRFRSVWPENTMCAKFQFTPTHVGLQRLTVEVDC 83
6 -15.400PF14646.6; H0WS01_OTOGA/246-665; MYCBP-associated protein family  ali follow..  24  232...IAVRLTF-ETVEGEKTSSDLTVVNNGTVADTFHDLKRNKMQRFYFNNREG-VILPGETKNFTFFFKSLTAGIFRESWEFGT 321
7 -12.400PF05753.14; Q9VUZ0_DROME/9-186; Translocon-associated protein beta (TRAPB)  ali follow..  12  25......QILNKYLVEKSDLLVRYTIFNVGSGAAVRLVDSGFHPEAFDVVGGQPTRIAPQTNFTHVLVVRPKAFGYFNFTAAEVS 108
8 -12.200PF10633.9; Q67M97_SYMTH/263-339; NPCBM-associated, NEW3 domain of alpha-galactosidase  ali follow..  13  4...............GRKNGVTLEVKNTGTTTGINFASTLPPNWTATFSPDSIDALAPGESRQVTVEVTPALAGDYLVTLRARS 77
9 -12.000PF07705.11; Q8TPY5_METAC/349-453; CARDB  ali follow..  13  2ADLGIQDVKVAKAWNKLNNTVSVTVINNGPENADSF-ALELYSDGTPVESRQVTGLANGATETVDFSWKPEDIKDYTLKAVVVP 89
10 -10.300PF06159.13; J3KCX7_COCIM/67-339; Protein of unknown function (DUF974 topsan)  ali follow..  13  4....PPA--FGSAYVGETFSCSLSANNEFLRASRVVTSIRELYPSSDDNDTKSGGIAQVESMQKIVRFDLKEEGNHVLAVGVS. 96
11 -9.330PF08626.11; C0NZX0_AJECG/5-1447; Transport protein Trs120 or TRAPPC9, TRAPP II complex subunit  ali follow..  16  823..............AEEPATFKVTLQNPEFDVEIESLRIDGTGIPFEAAATHGLWLAPFTTQEYYISGVAATEG----TLEIRG 889

FFAS is supported by the NIH grant R01-GM087218-01
1 3 9 8 0 4   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Pawlowski K, Jaroszewski L, Bierzynski A, Godzik A. Multiple model approach--dealing with alignment ambiguities in protein modeling. Pac Symp Biocomput. 1997;:328-39.