|
current user: public |
|
Query: PF12441.8; A1BIF8_CHLPD/6-84; CopG antitoxin of type II toxin-antitoxin system, from PfamA32U |
. 10 . 20 . 30 . 40 . 50 . 60 . 70 . | |||||||
# | Score | Template | Links and tools | %id | First | KTVPEFRSEQDEREFWATHDSSEYIDWEKAGTAIFPDLKPTMKTISLRLPEQMLNRIKVLANERDVPYQSLLKMFLKER | Last |
1 | -47.000 | PF12441.8; A1BIF8_CHLPD/6-84; CopG antitoxin of type II toxin-antitoxin system | ali | 100 | 1 | KTVPEFRSEQDEREFWATHDSSEYIDWEKAGTAIFPDLKPTMKTISLRLPEQMLNRIKVLANERDVPYQSLLKMFLKER | 79 |
2 | -12.100 | PF09274.10; Q9F809_ERWAM/1-76; ParG | ali follow.. | 10 | 31 | ......................................SGKSKRVNVNFNEEKHTRFKAACVKNGTSITDVINQLVDN. | 70 |
3 | -11.800 | PF14384.6; Q7CP71_SALTY/37-93; BrnA antitoxin of type II toxin-antitoxin system | ali follow.. | 20 | 1 | ...................DIPASEDGQWSEAVRGKFFRPLKTQASVRIDADVMEWLKR----PGKGYQTRLNAILRE. | 55 |
4 | -11.000 | PF05534.12; Q7MY97_PHOLL/58-110; HicB family | ali follow.. | 18 | 1 | .......................YIETCEEEGINPFKEEDKLKSFTLRYPGWLEARLTAAAISHAVSKNQFIVQLL... | 53 |
5 | -9.990 | PF04221.12; Q9KML3_VIBCH/3-84; RelB antitoxin | ali follow.. | 16 | 1 | .........................................TEMLSTRIDHDTKIAFTNVCDEMGLSTSQAIKLFAKA. | 37 |
6 | -9.960 | PF10723.9; Q326M6_SHIDS/1-79; Replication regulatory protein RepB | ali follow.. | 11 | 35 | .....................................KKGTHKAINVFIQSELKDDLTQLCKDSGLTQKEMIEHWILKE | 76 |
7 | -9.590 | PF07328.11; B9K404_AGRVS/5-145; T-DNA border endonuclease VirD1 | ali follow.. | 11 | 16 | .....................................TIEGFKVVSTRLRSAEYESFSRQARRLGLSDSMAIRIAVRRI | 57 |
8 | -9.290 | PF13467.6; Q2YPT7_BRUA2/7-71; Ribbon-helix-helix domain | ali follow.. | 18 | 11 | ..........................................HATSYTLEDPFFKIIEEIAAARNMTVAALVAEIDSRR | 47 |
9 | -9.010 | PF07878.11; Q46HT9_PROMT/14-56; CopG-like RHH_1 or ribbon-helix-helix domain, RHH_5 | ali follow.. | 24 | 1 | .........................................SPRIQVVLPEDLCERLSELAERESRTVSNMAKVLIQE. | 37 |
10 | -8.690 | PF12651.7; A5N8S1_CLOK5/8-51; Ribbon-helix-helix domain | ali follow.. | 15 | 1 | ........................................NRTRIYNAVDTILYTKLMQLSKEIMIPISKLLDKAVEL. | 38 |
FFAS is supported by the NIH grant R01-GM087218-01
|
![]() ![]() ![]() ![]() ![]() ![]() |
Selected papers from Godzik Lab Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9. Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018. Pawlowski K, Pio F, Chu Z, Reed JC, Godzik A. PAAD - a new protein domain associated with apoptosis, cancer and autoimmune diseases. Trends Biochem Sci. 2001 Feb;26(2):85-7. |