current user: public

If you have questions about the server, please let us know.

Query: PF12574.8; A0A0F3MK43_9RICK/404-636; 120 KDa Rickettsia surface antigen, from PfamA32U

Results of FFAS03 search in PfamA32U
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230
# Score Template Links and tools%idFirst ILEDESFKKWQEQNQNKTLDDFKHSAAQMDNLTPETKELISKLGAAGYANILGSGANIEQAQEMSFAASFCTLDWATQSNAVGNTTRKTITNEAGEKVVDLVSHSHSVQLSASVNGATKTITKCRTIDIPSTVEKGPLDLALVAQDSTGKNMPESKAVYFTVHYDQDGKIVEMTHPEPLKFFSETPSSPAYTVINGEIFTLPITKEKYEQLHKEISQNMEEQYAKDHQLAADKLast
1 -110.000PF12574.8; A0A0F3MK43_9RICK/404-636; 120 KDa Rickettsia surface antigen  ali  100  1ILEDESFKKWQEQNQNKTLDDFKHSAAQMDNLTPETKELISKLGAAGYANILGSGANIEQAQEMSFAASFCTLDWATQSNAVGNTTRKTITNEAGEKVVDLVSHSHSVQLSASVNGATKTITKCRTIDIPSTVEKGPLDLALVAQDSTGKNMPESKAVYFTVHYDQDGKIVEMTHPEPLKFFSETPSSPAYTVINGEIFTLPITKEKYEQLHKEISQNMEEQYAKDHQLAADK 233
2 -6.780PF15283.6; D3IEK1_9BACT/56-257; Domain of unknown function (DUF4595 topsan) with porin-like fold  ali follow..  13  1.........................................................................................IQTNEKGQIISMKSADKNIIFKYTEAVTRSIAPSPDVIMTVTGRDINKVVCNLYL-NKDGYEDRPETNHMYNFSYDRDGHLVEATIKG-------GEEVWSWIYENGDITRVERTDH........................... 120
3 -6.260PF03113.14; NS2_HRSVB/1-124; Respiratory synctial virus non-structural protein NS2  ali follow..  15  11....................................................................................................................QRLMITDMRPLSMDSIITSLTKEI-LINNECIVRKLDERQATFFLVNYEMK--LHKVGSTKYKKYTEYNTKYPIFINHGGFLECIGIKPTKHTPIIYKYDLN............... 123
4 -6.000PF13754.6; D4MVQ2_ANAHA/1-94; Domain of unknown function  ali follow..  17  3...........................................................................................................KRVFGKVDGIEVNYDH--NVPVP-LDIDGEYVIEVIAEDEAG-NQSFITRLLYTVK...................................................................... 60
5 -5.990PF18505.1; S6AEQ3_9PROT/1-87; Domain of unknown function (DUF5619 topsan)  ali follow..  3...............................................................................................................................TLHIASTEIALDFNAAIKLAAVIADNLTGENMLLSWYDRDRDLESPRGVSECHEGCPVKGFWDYGLNHGAELAVNFDDGRFVFC...................... 86
6 -5.940PF18140.1; A0A142YIS7_9PLAN/464-587; Propionyl-coenzyme A carboxylase BT domain  ali follow..  14  16..............................................................................................................ATSTSGQLPGHSRRVDIDWVVIMTDGPCKLAVSLEDQGCEILYEGKVHHLRTNWKLGDLLLKGTWDGNPVCVQIERVGLSYITHQGTQVDAMVMTARAAELLSVMPQK............... 124
7 -5.830PF11355.8; A3QJH2_SHELP/6-224; Protein of unknown function (DUF3157 topsan)  ali follow..  109..........................................................................................................NLLRSTAKGGAKVSYLKSQRLGLNFELSSNSIEMEIGLYADSGELIKTETVTYLRKGQTRDSETFWIEGIDKARW.................................................... 205
8 -5.680PF08308.11; Q5DZ92_VIBF1/315-383; PEGA domain  ali follow..  10  2.......................................................................................................................................................................VGITIRSNRHEDNVTVNGVSTPVDVMLPAGQHQITVEKSGFEPYRRQMSLTKDITVWADLKEQEN. 69
9 -5.590PF15418.6; Q5LII3_BACFN/21-149; Domain of unknown function (DUF4625 topsan)  ali follow..  20  95.............................................................................................................................DIKIPADATPGNYHLMVYCLDQSGNETYVVRNIVL......................................................................... 129
10 -5.560PF15064.6; F1RKJ0_PIG/1-950; Cation channel sperm-associated protein subunit gamma  ali follow..  13  789................................................................................ADPACIEAVVKQKDLINRNSVTLSDKRTCFDQGISGHHLMKTSMLIKVRSEPG-DGNLMVPLLIGCPPGKRLAFDITYTLEYNRLQNKHYFDCVHVDPPCFLFRDIFYPFFLIFQGS-YVLKVVGGGPTL--DTIKDYSEEDIY-RFNSPLDK 950

FFAS is supported by the NIH grant R01-GM087218-01
1 4 0 5 9 4   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Reed JC, Doctor K, Rojas A, Zapata JM, Stehlik C, Fiorentino L, Damiano J, Roth W, Matsuzawa S, Newman R, Takayama S, Marusawa H, Xu F, Salvesen G, Godzik A.; RIKEN GER Group; GSL Members. Comparative analysis of apoptosis and inflammation genes of mice and humans. Genome Res. 2003 Jun;13(6B):1376-88.