current user: public

If you have questions about the server, please let us know.

Query: PF12590.8; F6HH54_VITVI/1-128; Acyl-ATP thioesterase, from PfamA32U

Results of FFAS03 search in PfamA32U
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .
# Score Template Links and tools%idFirst MVATAATSAFFAVASPSSDPDAKPSTKPGVGSAILRGIKSRNAPSGSLQVKANAQAPPKINGTTVGYTSSAEGVKIEDDMSSPPPRTFINQLPDWSMLLAAITTIFLAAEKQWMMLDWKPRRSDMLIDLast
1 -98.100PF12590.8; F6HH54_VITVI/1-128; Acyl-ATP thioesterase  ali  100  1MVATAATSAFFAVASPSSDPDAKPSTKPGVGSAILRGIKSRNAPSGSLQVKANAQAPPKINGTTVGYTSSAEGVKIEDDMSSPPPRTFINQLPDWSMLLAAITTIFLAAEKQWMMLDWKPRRSDMLID 128
2 -9.140PF06094.12; E1Z6W3_CHLVA/3-115; Gamma-glutamyl cyclotransferase, AIG2-like  ali follow..  3.........VYGTLMYPEVLNALINRVPKMEPAVILGYQRYRIRGQVFPGTIRSAPDSQVAGMVLLDLQPDELEMFDEFEGDEYYKEGVEARLEGGAACPTTVYIWQDSLRSYLYGEWDP........ 113
3 -7.000PF14465.6; H3BF97_LATCH/376-475; NFRKB Winged Helix-like  ali follow..  16  10...........................................................LMEGPATLSVIEEKVLEWQSSPASTLNCWYSSAPNWSELVHSALQ-FLTAGMAALTPGFTP........ 69
4 -6.940PF03248.13; H3ANG1_LATCH/20-188; Rer1 family  ali follow..  19  66.........................................................PKVDPAVMEDSDDDEDGPSLPTRQNEEFRPFIRRLPEFKFWYSGTKAILVAM................... 117
5 -6.510PF10818.8; M4RK78_BIBTR/9-102; Protein of unknown function (DUF2547 topsan)  ali follow..  16  5..............................................................................................WTQFFFGIVAVLALPEVS................ 22
6 -6.300PF13053.6; Q81Q33_BACAN/1-89; Protein of unknown function (DUF3914 topsan)  ali follow..  18  11.......................................SQPTKITPSNLEHNTISSTKLESKKVNDPIKFDIRSSEKEMKQPEHK--FNELDLWKMLKDKGVPLWIILE.................. 79
7 -6.250PF05664.11; M0RWR1_MUSAM/35-734; Plant family of unknown function (DUF810 topsan)  ali follow..  12  15FMSCRSSPGFGGGSRSPLNYLPSSSSSPWSAAAFDGGSGSGGEGSPKTGMTRGLNSPGKLKRPMTSAEIMRLQMRVTEHSDHRLRKTLMRTLV----LLRQLKPSEFNDAREY--HQWQRRQLKIL.. 149
8 -6.090PF04403.13; B3EAR6_GEOLS/49-206; Paraquat-inducible protein A  ali follow..  11  4CWALLLASYILYIPANLMVMMETGTLISYRKDTILSGVIHLWHNG-ATIVFIASILVPLFKLVVLTLLLLSVRRGSTWGIKHRIK-RIVELVGRWSMLDIFVVTLLAALVQIQSFAT........... 124
9 -6.010PF08654.10; K1Y854_MARBU/31-128; DASH complex subunit Dad2  ali follow..  16  8..................................................KAELENLKQLRDLSAGLAGQMQMLEEKLSTLSDGTEAVATVLGNWHNVLRAISMASMKIPKP................ 69
10 -5.960PF02616.14; P74212_SYNY3/16-259; Segregation and condensation protein ScpA  ali follow..  13  5.........................................................................................GEINPWDVSVIDVIDRFLQDLGILNSLDLNFQQQNL... 40

FFAS is supported by the NIH grant R01-GM087218-01
1 4 0 1 8 0   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Wooley JC, Godzik A. Probing metagenomics by rapid cluster analysis of very large datasets. PLoS ONE. 2008;3(10):e3375. Epub 2008 Oct 10.