current user: public

If you have questions about the server, please let us know.

Query: PF12719.7; M3XT68_MUSPF/558-858; Nuclear condensing complex subunits, C-term domain, from PfamA32U

Results of FFAS03 search in PfamA32U
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300
# Score Template Links and tools%idFirst KCLILCYELLKQMSTSTGIGATMNGIIESLILPGIVSVHPVIRNLAVLCLGCCGLQNQDFASKHFVLLLQVLQIDDVTIKISALKAIFDQLMMFGIETFKTKNKALQGENAEINTDGDQDIKDAKEETATAKNVLKLLSDFLDSEVSELRTGAAEGLAKLMFSGLLVSSRILSRLVLLWYNPVTEEDVRLRHCLGVFFPMFAYASRTNQECFEEAFLPTLQTLASAPASSPLAEVDITNVAELLVDLTRPSGLNLQAKNSQDYQALSVHDNLAIKICNEILTCPCSPEIRVYTKALGSLELLast
1 -91.800PF12719.7; M3XT68_MUSPF/558-858; Nuclear condensing complex subunits, C-term domain  ali  100  1KCLILCYELLKQMSTSTGIGATMNGIIESLILPGIVSVHPVIRNLAVLCLGCCGLQNQDFASKHFVLLLQVLQIDDVTIKISALKAIFDQLMMFGIETFKTKNKALQGENAEINTDGDQDIKDAKEETATAKNVLKLLSDFLDSEVSELRTGAAEGLAKLMFSGLLVSSRILSRLVLLWYNPVTEEDVRLRHCLGVFFPMFAYASRTNQECFEEAFLPTLQTLASAPASSPLAEVDITNVAELLVDLTRPSGLNLQAKNSQDYQALSVHDNLAIKICNEILTCPCSPEIRVYTKALGSLEL 301
2 -11.200PF05918.11; D7TJH2_VITVI/11-547; Apoptosis inhibitory protein 5 (API5)  ali follow..  11  2EKLYEYGERLNEAKDKSQNVEDYRGIIA------AAKGSIKAKQLAAQLIPRFFKFFPDLSDAAVDSHLDLCEEEELGVRVQAIRGLPLFC---------------------------------KDTPEYVSKIVDILAQLLTAEENVERDAVHKALLSLLRQDVKASLTGLFKHIMTVDDPSTDENLRVLNFIRDKVFPLKAELLKPQEQMERHITNLIKKSLEDVTGAEFKMFAPPERVQELIEIIEGQADLDAQFNVSDGDRGASNSKFLNYLNKHIIPVFDKLPEERKLDLLKNL.. 293
3 -10.100PF10508.9; A7SP09_NEMVE/2-505; Proteasome non-ATPase 26S subunit  ali follow..  10  64.CKNILKNILKFEK-----PDAPATKYHDAVIEGLNHPTEDVRELCLIELERCSGTVNGVLADLLSYIARGMADEHLKNAQIASNVFTNLA-----------KHEAGLKVLFDSHLQSEFNALLKTKDTVRMRVYDMYITVQAHSPKAFDVCKESGIFEKLI-SELDGRDVLVQM----------------NCLELLTKLASISPSGLEYLDQKGVVTKLNNLLLEVETDPLITLIIPGIIKFFGTLATAHPLETTQQYPQ-----------FLEQTYSMISCGDPTLMPIAMETIGVI.. 322
4 -10.000PF12530.8; D8SAX6_SELML/484-706; Protein of unknown function (DUF3730 topsan)  ali follow..  15...NVVIAFLNALPDICGHPTTVPLSMHLLQHMVDYKGNLRIQATSIRLIYKIWQHTDRAYSFLQKTLVPSWFSQAKDVLLSRATSLRDLC---------------------------------GHDPDVGIELILSVQACVECRSPVVKALGLQSLSFLCGHDAIDFYTAWKVIAKLF--SPLPISPSISESFCMLLKHGALDANLNAEDAHAVLNALWEFASCDKQPSEEWYRTRSAAVESL......................................................... 223
5 -9.200PF04826.13; ARMX3_MOUSE/110-363; Armadillo-like  ali follow..  12........................QELQKVLCLVEMSEKPYILEAALIALGNNAAYAFNRDLGGLPIVAKILNTRDPIVKEKALIVLNNLSV-----------------------------NAENQRRLKVYMNQVCDDTVTSRLNSSVQLAGLRLLTNMTVTNE--YQHILANSISDFFRLFSAGNEETKLQVLKLLLNLAENPAMTRELLRAQVPSSLGSLFNKKEYKEV----ILKLLIIFENINDNFKWEENEPAQNHFSEGSLFFFLCADKVLGIESRHDFQVRV........... 251
6 -9.130PF13646.6; C3YB05_BRAFL/324-412; HEAT repeats  ali follow..  20  4..............................LKKLLVDEDPNIRAVASIALGKTG----TCTPDIVEALVNLLKDEDRLVRESTCVSLGYL---------------------------------------AQDAVPHVINAWRNDPISHVREAAQAAL................................................................................................................................................ 88
7 -8.920PF16213.5; K1QEZ5_CRAGI/9-185; Dimerisation and cyclophilin-binding domain of Mon2  ali follow..  8..........................................................ESLQGDLRSLSAEGKRKYPHVKEASEQIQLKL-----------------------RTICTKSEDVMSGLVPASAEIIQPFVMGCDTKNPKIVQLCLTSVQKLISHEAISVTALLQTAIILITTNSVVQHDSLAKALVLCFRLHFTKDSTTINTAAATIKHLVSCVFERVVTED...................................................................... 177
8 -8.340PF12717.7; G8Y240_PICSO/105-271; non-SMC mitotic condensation complex subunit 1  ali follow..  14  2.........................................IRALAIRTMG--CVRVARMVDFIEIPLKRTLSDDNPYVRKTAAICVAKLFDL-------------------------------SPKACVEFGFLDQLRGLIKDSNPMVVANALNSLFEIK-DSSLVVLEFDSELIKTLLMCLNECTEWGRITILDTLTKYEASSSEEASHIIDRATPQLQHANPS........................................................................... 156
9 -8.310PF11701.8; F6ZSU7_XENTR/243-434; Myosin-binding striated muscle assembly central  ali follow..  13  58..ASVLLNKLFDDLKCDAERENFHKLCEDYVRSLFEGHGMDGKLRSIQTVSCLLQGPSEAGNRIMESIISLCASEREIDQQVAVEALIYAA------------------------------GKAKRASFITANGVALLKDIYKNENDAIRIRALVGLCKL............................................................................................................................................. 192
10 -8.160PF12348.8; B8M2E9_TALSN/325-551; CLASP N terminal  ali follow..  12  26KSVETLRRLVRGNAPQTYSQHFIAGILLDGILKVVNSLRTTLSTTGCLLIQEIA---DNMVEILLQNMIKLCAGMKKISAQNANATVDAII----------------------------------SNVTYVPRILQHLSFACQDKNVQPRLFAAGWLKTLL---SIEHGGGLDLVEKCIKKCLGDPNPGVRESMRGTFWTFYKIWPDRAEEIISTLDAKSKTLLE............................................................................ 227

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 1 4 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Friedberg I, Nika K, Tautz L, Saito K, Cerignoli F, Friedberg I, Godzik A, Mustelin T. Identification and characterization of DUSP27, a novel dual-specific protein phosphatase. FEBS Lett. 2007 May 29;581(13):2527-33. Epub 2007 Apr 30.