current user: public

If you have questions about the server, please let us know.

Query: PF12755.7; C4QYN7_KOMPG/59-156; Vacuolar 14 Fab1-binding region, from PfamA32U

Results of FFAS03 search in PfamA32U
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .
# Score Template Links and tools%idFirst NSRNGGLIGLAATAIALGQHEVPKYLEKIIHPVLACFGDQDARVRYYACESLYNISKVAKGEILLYFNEIFDNLCKLTADSEVSVKKGADLLDRLIKDLast
1 -49.500PF12755.7; C4QYN7_KOMPG/59-156; Vacuolar 14 Fab1-binding region  ali  100  1NSRNGGLIGLAATAIALGQHEVPKYLEKIIHPVLACFGDQDARVRYYACESLYNISKVAKGEILLYFNEIFDNLCKLTADSEVSVKKGADLLDRLIKD 98
2 -17.100PF12348.8; B8M2E9_TALSN/325-551; CLASP N terminal  ali follow..  14  22IPREKSVETLRRLVRGTYSQHFIAGIKSLLDGILKVVNSLRTTLSTTGCLLIQEIAKVCGPGIDNMVEILLQNMIKLCAGMKKISAQNANATVDAI.. 121
3 -14.800PF12717.7; G8Y240_PICSO/105-271; non-SMC mitotic condensation complex subunit 1  ali follow..  18  3..RALAIRTMGCVR-------VARMVDFIEIPLKRTLSDDNPYVRKTAAICVAKLFDLSPKACVE--FGFLDQLRGLIKDSNPMVVANALNS...... 83
4 -14.400PF13646.6; C3YB05_BRAFL/324-412; HEAT repeats  ali follow..  16  1.............................VSSLKKLLVDEDPNIRAVASIALGKTGTCT--------PDIVEALVNLLKDEDRLVRESTCVSLGYLQA 61
5 -13.300PF12460.8; H6C711_EXODN/528-954; RNAPII transcription regulator C-terminal  ali follow..  15  349TEKENYLIALSGILASVPSNIVMPELPTLLPLLLQSLDVTDQMVKTATLETLAVVISNNPAEESGHIPALVKRLIAV..................... 427
6 -13.300PF13251.6; Q29FP6_DROPS/352-529; Domain of unknown function (DUF4042 topsan)  ali follow..  15  1SVRISALHLMSALTKQLPRRSLYGYWHVIFPLLHLAKNDANSRCRALALQLAGQLLYGSKGYLSQAHSRGPCTFTPFSVSLARSVMTVYRSLTSILDR 107
7 -12.500PF13513.6; I1N8A0_SOYBN/478-532; HEAT-like repeat  ali follow..  12  2RVQAHAASAVLNFTENCTPDILTPYLDGIVSKLLVLLQNGKQMVQEGALTALAS............................................ 55
8 -12.100PF10508.9; A7SP09_NEMVE/2-505; Proteasome non-ATPase 26S subunit  ali follow..  15  59DQITYCKNILKNILKFEKPDAP---ATKYHDAVIEGLNHPTEDVRELCLIELERCSGTVNGVLALMDKELLSYIARGMADEHLKNAQIASVFTNLAKH 155
9 -11.600PF10363.9; A0A1X7V8A1_AMPQE/783-906; Required for nuclear transport of RNA pol II C-terminus 1  ali follow..  12  16..KGHGLQQLSQLVRKKDSETLAH-IDHTIELFLTHLGHSDTYIYLPSIQGLVELASLVPDRIIPLMCNEYAQFNEARKARASCGTLEGKSIDWLVK. 109
10 -11.600PF10521.9; L8G7H9_PSED2/153-432; Tti2 family  ali follow..  12  98....HAVTVFKWVVTTADEDLISNNWHLFIPPLMTLLDDPTTSVRASGLTILSEFLKKTSPRMLVLRDLLEEALMPTLSPTLTPVAESQLLLKKAYS. 195
11 -11.400PF05004.13; T1J854_STRMM/21-332; Interferon-related developmental regulator (IFRD)  ali follow..  17  207....SALAAWSLLLTVVSINDVSSMAERHVMRLSELLESSDVELRIVAGETIALLYEIAREEDENFLDDLSFKLKQLATDSHKYRKKERKQQRSSFRD 306
12 -10.500PF11865.8; Q7S6V7_NEUCR/738-897; Domain of unknown function (DUF3385 topsan)  ali follow..  10  83........................YPTVVINALLQILKDQSVQWHGNVVDAIMSIFITLGLKCVQFLDRVVPAFISVIRASSNARLEHLSRLVSIVR. 160
13 -10.400PF11698.8; K5XHD3_AGABU/314-430; V-ATPase subunit H  ali follow..  13  42...........................EQLKKLINLLSSDDPNILAIAANDVGQYVKHYERGKKFVTDGGKDRVMELMAHTNPEVRYRALLSVQQL.. 112
14 -10.300PF04826.13; ARMX3_MOUSE/110-363; Armadillo-like  ali follow..  14  110SVQLAGLRLLTNMTVT---NEYQHILANSISDFFRLFSAGNEETKLQVLKLLLNLAENPAMTRELLRAQVPSSLGSLFNKKEYKILKLLIIFENINDN 206
15 -10.100PF05804.12; KIFA3_HUMAN/13-720; Kinesin-associated protein (KAP)  ali follow..  14  265QLLRVALYLLLNLAEDTRTELK----KNIVHMLVKALDRDNFELLILVVSFLKKLSIFMENKNDMVEMDIVEKLVKMIPCEHEDLLNITLLLLNLSFD 362
16 -9.990PF17741.1; A0A151PBS4_ALLMI/1-268; Family of unknown function (DUF5578 topsan)  ali follow..  14  163KAQRQVQILLDSLGHG------PKYQNQVYKGLIALLPCTSPHAQQLSLQTLRVVQAIVGKS-----PSIVEAVLGVLRSMELEVQYEAILIKDLTSY 252
17 -9.860PF11919.8; G1XAQ8_ARTOA/1870-1959; Domain of unknown function (DUF3437 topsan)  ali follow..  12  3.NRHAAVLGLNALVQAFPYVSPPPWLPEVLTILALRAASDPGMVGESVKTCLSDFKKTRQDTWHIDVKAFTSDQLEDLEG.................. 82
18 -9.690PF05918.11; D7TJH2_VITVI/11-547; Apoptosis inhibitory protein 5 (API5)  ali follow..  16  36KAKQLAAQLIPRFFKFF-----PDLSDAAVDSHLDLCEEEELGVRVQAIRGLPLFCKDTPE----YVSKIVDILAQLLTAEENVERDAVKALLSLLR. 124
19 -9.670PF10274.9; A8BDI0_GIAIC/52-235; Parkin co-regulated protein  ali follow..  11  36.........................FHHYLPIFFEGLREKDHPYAFLAREGVTNLLEHGGSKVLPVIPQLILPLHAALETRDPEVICVVLNVLQLL.. 106
20 -9.630PF08623.10; B8LYD7_TALSN/1156-1323; TATA-binding protein interacting (TIP20)  ali follow..  14  41DLRKTAYETLYASLDAALNRI----VSELFDRILAGLDDEQ-DIRTLCNLMTAKLITLAPAEIQRQLDSLSERYTAVLT-KENAVKQEIEKAQEASL. 135
21 -9.600PF07571.13; M0TF62_MUSAM/263-351; TAF6 C-terminal HEAT repeat domain  ali follow..  6............................VAKRLGSKITDNHWELRDFSANLAASVCKRYGHVYHNLQSRLTKTLINAFLDPSKALTQHYGAIQGLAA. 74
22 -9.530PF12830.7; K5W4K0_PHACS/1606-1788; Sister chromatid cohesion C-terminus  ali follow..  13  5.........................VQRYLQHILDAALSREAQIQGPAVDILTFTIKQ----------QCFPIIVALETSPNSVLSGRANALHGILHS 73
23 -9.510PF01602.20; Q22601_CAEEL/28-590; Adaptin N terminal region  ali follow..  13  102.......LALQCISNMGSREMVEAFCTDLPKLL--VSGETIDFVKQSAALCILKLFRNSPDSFQP--GDYASRIVHLLNDSHMGVVTSAASL...... 182
24 -9.310PF17822.1; G3S7I6_GORGO/1-229; Family of unknown function (DUF5584 topsan)  ali follow..  12  116KIKILLLQSVACWCYLNPVSQKRAKSLQFIPILISFFEGRFELLKFWTCYVLSVMTCNNLSCVKELKDH-LKYHLQMLAAENWS-ENFAEVLYFLI.. 225
25 -9.040PF12074.8; G2YHH1_BOTF4/364-719; Generalcontrol nonderepressible 1 (Gcn1) N-terminal  ali follow..  16  2DQRANYAEMLAILPVS---KSNASAAIGLATIA----KEANEAALLAETSALLHYLKNRVQNESPLDKSIVTSFTKGISDKKVPVKKLTIRLGELLWD 94

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 5 6 5   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Rychlewski L, Zhang B, Godzik A. Functional insights from structural predictions: analysis of the Escherichia coli genome. Protein Sci. 1999 Mar;8(3):614-24.