current user: public

If you have questions about the server, please let us know.

Query: PF12799.7; A4HHM1_LEIBR/66-108; Leucine Rich repeats (2 copies), from PfamA32U

Results of FFAS03 search in PfamA32U
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40
# Score Template Links and tools%idFirst KWLKYLNLAVNNITVIDGLQGCEALERLDLTLNFIAEPTSVQTLast
1 -23.400PF12799.7; A4HHM1_LEIBR/66-108; Leucine Rich repeats (2 copies)  ali  100  1KWLKYLNLAVNNITVIDGLQGCEALERLDLTLNFIAEPTSVQT 43
2 -13.500PF14580.6; H3BFR2_LATCH/1-175; Leucine-rich repeat  ali follow..  20  42DQFDTIDFSDNEIRKLDGFPLLKRLKTLLMNNNRICRIGE... 81
3 -10.000PF13855.6; C3Y9A4_BRAFL/119-179; Leucine rich repeat  ali follow..  31  2.RLYDLSLDSNRLTHVKQFTGLENLLSLTLSNNRIEKIE.... 41
4 -3.400PF14814.6; I2BCM2_SHIBC/123-207; Bifunctional transglycosylase second domain  ali follow..  16  61.....LTFDGERLASIKNVATGREFGYLRL............. 85
5 -3.400PF00820.19; OSPB_BORBU/36-296; Borrelia lipoprotein  ali follow..  11  224VFLTDGTITVQQYNTASLEGSASEIKNLSELKNALK....... 261
6 -3.030PF12789.7; A2E9H7_TRIVA/234-293; Phage tail repeat like  ali follow..  22  7........HTHTIANITNLQETLNRKSDVGHTHSISEITDLQE 41
7 -2.960PF05725.12; Q8SSW4_DICDI/523-566; FNIP Repeat  ali follow..  15  12KSIINLTFGDHFNQPIEKDVLPPSLKVLKFSGS.......... 44
8 -2.900PF15435.6; G3Q356_GASAC/3-207; UNC119-binding protein C5orf30 homologue  ali follow..  28  170KSLDYLNLDKITIKESSDTEVLQQLQHLTLRGERM........ 205
9 -2.820PF03703.14; Q2S4T2_SALRD/280-363; Bacterial PH domain  ali follow..  17  11...DKLRKRHGLFTVTEGTIPLDKVQALILRTNPFMRAFGWYE 50
10 -2.770PF12613.8; C5AK60_BURGB/238-290; Flagellin structural protein  ali follow..  19  28......SAAANMISQINAVNAPPTVSNVDISN........... 53

FFAS is supported by the NIH grant R01-GM087218-01
1 4 5 9 0 4   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Pawlowski K, Pio F, Chu Z, Reed JC, Godzik A. PAAD - a new protein domain associated with apoptosis, cancer and autoimmune diseases. Trends Biochem Sci. 2001 Feb;26(2):85-7.