current user: public

If you have questions about the server, please let us know.

Query: PF12862.7; APC5_SCHPO/263-353; Anaphase-promoting complex subunit 5, from PfamA32U

Results of FFAS03 search in PfamA32U
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90
# Score Template Links and tools%idFirst YYCKFLNSWFSGDYQQSVENLCRYFDHIMHSDEKVSYQYALLNLAMLQADFGCNEEALHAIEDTINTARESGDTACLNFALAWMFEFKRSQLast
1 -55.600PF12862.7; APC5_SCHPO/263-353; Anaphase-promoting complex subunit 5  ali  100  1YYCKFLNSWFSGDYQQSVENLCRYFDHIMHSDEKVSYQYALLNLAMLQADFGCNEEALHAIEDTINTARESGDTACLNFALAWMFEFKRSQ 91
2 -28.600PF13424.6; Q4DK03_TRYCC/687-760; Tetratricopeptide repeat  ali follow..  11......LKCQLGDMLSALSLQETELEIAKEFGDTRATSRCMGAIALTKRFLGRYDEAAENYMEELSVYNA..................... 74
3 -27.100PF10579.9; Q8QGW4_DANRE/1-80; Rapsyn N-terminal myristoylation and linker region  ali follow..  22  14.....LKLYQSNDTEKALYVWMKVL---RKTSDPGGKFRVLGCLITAHSEMGKYKEMLQFSLAQINTAREMEDP................. 79
4 -23.200PF17139.4; R7EHD4_9BACE/12-276; Domain of unknown function (DUF5112 topsan)  ali follow..  46.....FCAFMRMDFEQAEKFHMDVYNLT---KNELELLIADIGLMKIYQRTALNKEFYDYRNSALHRMKRIAEDDNLFVDQHEQMRLNYAR 128
5 -20.200PF14938.6; B8ML21_TALSN/2-284; Soluble NSF attachment protein, SNAP  ali follow..  45.......FRVQRLNKEAGMAFEKAAAVQKNNLNEPDDAANSLSEAFKVYRKTDPEDAVRVLAGAIQHYISKGNFRRAATHQQNLAECYEVE 128
6 -19.800PF12968.7; Q8KAL8_CHLTE/2-144; Domain of Unknown Function (DUF3856 topsan)  ali follow..  16  17.....QRQLVAGEYDEAAANCRRAMEISHTMPPEEADAFCHAGLAEALAGLRSFDEALHSADKALHYFNRRGELNSRALALDGLGRGAEA. 119
7 -19.300PF08631.10; H2L969_ORYLA/170-426; Meiosis protein SPO22/ZIP4 like  ali follow..  10  1......SAIAQGNNQEAIVFIERCKDILLRLPNETAYSVVCYNFGIEAYNLTKFEDSAFWLSQSYDIGKANMGSEALAKVLRLLATCY... 87
8 -19.100PF10602.9; RPN7_SCHPO/77-250; 26S proteasome subunit RPN7  ali follow..  10  9..........IKKNEEKLAEFDKAIEDAQELNGEHEILEAMKNKADYYTNICDRERGVQLCDETFERATLTGMKIDVLFSKIRLAYVYAD. 88
9 -17.900PF12688.7; Q9RUW3_DEIRA/41-159; Tetratrico peptide repeat  ali follow..  13  4LFERAGARDSVGREAEAVQLYEQALAAGLSGVRR---RRAVIQLASSLRNVGQVERGLALLEAEQQRGPDELSSAFLALMLVDTGREREA. 93
10 -17.000PF13371.6; Q1LJ97_CUPMC/200-272; Tetratricopeptide repeat  ali follow..  11  4......IYLQESRWQRLLAVQNRLVIL------LPDSIEEVRDRGLAYANLECFRPALEDLEAYVQARPDAADSTQIRDRM.......... 72
11 -16.600PF13432.6; A1AQL4_PELPD/29-93; Tetratricopeptide repeat  ali follow..  15  6......AYLKLNLVDDALHTARRGVEK------FPAYVAGQRSLALACYAKGLMDESRQALEAVVAAVPE..................... 63
12 -16.500PF14559.6; E3HZX0_RHOVT/142-209; Tetratricopeptide repeat  ali follow..  11  2........FEEGDIAGAAQLYGAVLKNDRENAD------AIGGLSKCYVRLDDLARAEQVLSMTPPAKQTAEAYLSAKAAL.......... 68
13 -16.200PF10952.8; F0LVC6_VIBFN/6-145; Protein of unknown function (DUF2753 topsan)  ali follow..  10......IAMQQADHLRSILHYQQALTLSDRIGVAEEIE-SCHNMAGFWRTIGDDQYELKYLELASERILTLIPQCGNPSCEAFVDSL.... 99
14 -16.000PF07079.11; O84657_CHLTR/57-602; Protein of unknown function (DUF1347 topsan)  ali follow..  13  472........FAKGDYRLCIVYSSWLARAAPS-------TEALQLLGLSLVEQKEYTEALEVFQRLPLGEDTWNSQVHKASLLCYKYIARQQ. 546
15 -15.700PF12569.8; A7S752_NEMVE/188-686; NMDA receptor-regulated protein 1  ali follow..  188YFFLSQHYDHLRDTEKALDYINKAIDHTPTLIE------AYMVKGRIYKHAGDIDKAAEIMDEARAFDTADRYNCKCAKYQLRANQVQKA. 272
16 -15.700PF17826.1; G1SXV9_RABIT/101-469; Family of unknown function (DUF5588 topsan)  ali follow..  18  59.......AYRQGEYQKALQEYSSIAEKLSP-TNFSMKRDIQEGQARCLAHLGRHQEALEIATELENKATNTDH---LTTVLYLQFAICSS. 137
17 -15.500PF16065.5; E2AQ63_CAMFO/137-267; Domain of unknown function (DUF4807 topsan)  ali follow..  13  34.WLSTLAFSALGEEKMAGKISMRQFELALRLDNPLLIARCRLYSALSLIQRGYFTTPKYMIQRIYKFAIKEKDVRLQNMCQGVWAKL.... 126
18 -14.700PF17874.1; W4QMK5_9BACI/433-753; MalT-like TPR region  ali follow..  11  129.......YYEWNDLDKAEWHGQQAIQLSRQFENTDRSVASEVFLARLKFVQGEAANATAILDNAEQVARLNHFSYQISEIEAVRVQIFLGQ 212
19 -14.500PF09986.9; Q898V4_CLOTE/16-227; Uncharacterized protein conserved in bacteria (DUF2225 topsan)  ali follow..  141.............LTNALKGFIEAYESEEFPIFGMDKYTIMYLIGELNRRLGDKDKALLWFSYVITTPNVSYKLKSMARDQRDL....... 211
20 -14.300PF15015.6; SPT16_MOUSE/5-569; Spermatogenesis-associated, N-terminal  ali follow..  182......SCYRQKKYAVAAGQFRTALELAHAEDIASIASFIETKLVTCYLRMRKPDLALNHAHRSIVLNPAFRNHLRQAAVFRCLERYSEA. 278
21 -14.100PF13429.6; Q39U81_GEOMG/198-480; Tetratricopeptide repeat  ali follow..  13  226......ALAYLGEYHKALPYFQARYSQKRS------DPAWLAAYADTMEQAGWVEAAFLERLNALALSRR..................... 283
22 -14.000PF11349.8; C6WR17_ACTMD/8-134; Protein of unknown function (DUF3151 topsan)  ali follow..  38WALLAETALDNDDPVAAYAYARTGYHRGLDQ-PNQGFLRSLAALSRAAGGIGEVAEQDRCAKFLADSDPTAPAQ................. 127
23 -12.500PF09976.9; C7RN42_ACCPU/16-225; Tetratricopeptide repeat-like domain  ali follow..  14  85......AMFAAGDTKTASLQLVWVVE----HGKDELRDLARLRLAAVLLDEKAYDEALKQLAGNTTGGFAVRFLGSRGDVLSAQGKTAEAR 165
24 -12.400PF16918.5; V9XE69_9NOCA/412-767; Protein kinase G tetratricopeptide repeat  ali follow..  12  105......AHLDLGQVDSAVEILTRLERESGD------DWRMDWYAGIAELLQDDYEAAFTRFDKVLQALGEIAPKIALGATAELTLQHWESD 184
25 -12.200PF14561.6; B6IUQ4_RHOCS/220-309; Tetratricopeptide repeat  ali follow..  16  1..........QARQAGPVPELMNRLARDPDDHQ------TRYDLALALYAAGKAEAAVEALLEIVKRDRDWNEQAARKQLLKFFEAFGPTD 75
26 -12.200PF04733.14; COPE2_ARATH/7-293; Coatomer epsilon subunit  ali follow..  12  177.......AVGGSKIQEAYLIFEDFSEKYPMTCL------ILNGKAVCCMQMGNFDEAETLLLEALNKDAKDPE------TLANLVVCSLHV 248
27 -12.100PF09613.10; F5XVY8_RAMTT/1-126; Bacterial type III secretion protein (HrpB1_HrpK)  ali follow..  10  21.......GSDLEEDAQTLVVLRAIRRL------RPHAPTLAVVEAQQLVENGDLQGARLLLEEADACSPG..................... 77
28 -12.100PF13512.6; Q6LMX6_PHOPR/21-165; Tetratricopeptide repeat  ali follow..  12  14.YVTAQQALQSGSWTTAIERLETLDSRY----FGAYSEQVQLDLIYAYYKNDDLALGEATIARFNR......................... 75
29 -12.000PF09295.10; Q6CDA2_YARLI/40-455; ChAPs (Chs5p-Arf1p-binding proteins)  ali follow..  10  269.......LLSKNREDMALGCATRAVNSAPS------ESKLWTELVQVYIRQKDWENALLTLNSCPMFTYHEHD.................. 328
30 -11.400PF09477.10; Q7N0U7_PHOLL/1-115; Bacterial type II secretion system chaperone protein (type_III_yscG)  ali follow..  16  48.....SSLTNQGKYQQALDFGRDLPW-----------PSLEPWLALCEWRLGLASALEQRLTRMA----GSDDPQLLSFVDGMREQL.... 114
31 -11.400PF13374.6; CLU_HUMAN/1019-1060; Tetratricopeptide repeat  ali follow..  23  2.....................................CACLRLLARLHYIMGDYAEALSNQQKAVLMSERV.................... 35
32 -11.400PF06552.12; TO203_ARATH/7-193; Plant specific mitochondrial import receptor subunit TOM20  ali follow..  3.........RILLFEQIRQDAENTYKS------NPLDADNLTRWGGVLLELSQIQEAITKFEEALLIDPKKDEA-CIGNAYTSFAFLTPDE 89
33 -11.000PF17004.5; E0SAD0_ENCIT/8-116; Putative TPR-like repeat  ali follow..  20...RAVAYINMGKFGEALKYAEKRYKKALRILRYLDTEGSKVLASQCLYYLGYYNTAYKVLSEIKKDDEIVINLQAM.............. 106
34 -10.900PF12895.7; A5DQ17_PICGU/77-157; Anaphase-promoting complex, cyclosome, subunit 3  ali follow..  10  5.............YQTAAFVGDKVLSLTHDAND-------AFWLAQVYYNSGQYLRAKELISGKPEYEKSVTCRYLAARSAIKLELWDEA. 74
35 -10.800PF08626.11; C0NZX0_AJECG/5-1447; Transport protein Trs120 or TRAPPC9, TRAPP II complex subunit  ali follow..  14  315...........................ASERSKSRVKGRLNIVMGTLFLQAGRWPDSLKELAEGATIARANSDYIWHAKALESI....... 371
36 -10.100PF13176.6; Q8YTD5_NOSS1/458-493; Tetratricopeptide repeat  ali follow..  28  1.......................................SLNNLAELYRSQGRYREAEPLFIDALAMTKRL.................... 32
37 -9.810PF10345.9; Q6CDL4_YARLI/63-642; Cohesin loading factor  ali follow..  12  474FEVIRLVHDTSNMSSLDRQESMKKAQKALHLGMTQQLSYATTLACVDM--FGSTAEKNLELGNAFRTALSESDCVWAYVIGEKKKGYLHQL 562
38 -9.730PF04781.12; B3H4B1_ARATH/23-139; Protein of unknown function (DUF627 topsan)  ali follow..  61.............LFASLDAFSMFTLPCDALKSFRGCVLSLIQLGDQLGIKKFYRKAASKAYQALSVTN...................... 117
39 -9.540PF04184.12; F7I5Z8_CALJA/4-540; ST7 protein  ali follow..  15  206.....LAEEEATTIAEAEKLFKQALKAGDGC-DTNVLVYIKRRLAMCARRLGRTREAVKMMRDLMKEFSMFNIHENLLEALLELQAYADVQ 313
40 -9.480PF04910.14; A5DAW3_PICGU/281-612; Transcriptional repressor TCF25  ali follow..  47.QVAMILLRQGGDKATSNALVERCLFIFDRA-ANRQFYLCLFRYIVALGERNLFSTALNYCKLLLGFSPG-EDPVGVRYYIDFY....... 151
41 -9.300PF16068.5; Q9I786_PSEAE/26-108; Domain of unknown function (DUF4810 topsan)  ali follow..  14  7YQAQVHEYFKGESKEAQAQALEADLEKIRAKNGAVPPG-YHAQLGLLYSSIGKDDQMVREFETEKALFPESA................... 77
42 -9.160PF00515.28; OGT1_RAT/147-180; Tetratricopeptide repeat  ali follow..  25  3.......................................VRSDLGNLLKALGRLEEAKACYLKAIETQPN..................... 33

FFAS is supported by the NIH grant R01-GM087218-01
1 3 9 8 0 4   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Pawlowski K, Jaroszewski L, Bierzynski A, Godzik A. Multiple model approach--dealing with alignment ambiguities in protein modeling. Pac Symp Biocomput. 1997;:328-39.